Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Rabbit anti-NFKB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFKB2 |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Antibody against MEF2C (S387)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEF2C antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-394 amino acids from human MEF2C. |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
NFATC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human NFATC2 |
Rabbit Polyclonal Anti-Atf4 Antibody
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Atf4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NFKB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NFKB1 |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal NFkB p65 phospho S536 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
Rabbit polyclonal DDIT3 Antibody (C-term A135)
| Applications | FC, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DDIT3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the C-terminal region of human DDIT3. |
Rabbit polyclonal JUN Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit Polyclonal CHOP (Ser30) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CHOP around the phosphorylation site of Serine 30 |
| Modifications | Phospho-specific |
Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536 |
| Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
| Modifications | Phospho-specific |
Rabbit polyclonal ATF-4 (Phospho-Ser219) antibody
| Applications | WB |
| Reactivities | H:S219, M:S218 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ATF-4. |
| Modifications | Phospho-specific |
CHOP Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHOP |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit Polyclonal NF-kappaB p65 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65 |
Rabbit anti-FOS Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human FOS |
Rabbit anti-MEF2C Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MEF2C |
Rabbit Polyclonal Anti-M3K13 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-M3K13 Antibody: A synthesized peptide derived from human M3K13 |
Rabbit monoclonal antibody against NFAT1 (clone EPR2973 )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal NFAT3 (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NFAT3 around the phosphorylation site of serine 676 (K-R-SP-P-T). |
Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R). |
| Modifications | Phospho-specific |
Active filters
Applications
- WB
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- MAPK signaling pathway
Filter by
Category
Target Symbol
- TP53 (36)
- RELA (30)
- JUN (25)
- ATF2 (17)
- MYC (15)
- IKBKG (14)
- NFKB1 (12)
- FOS (10)
- RELB (10)
- ELK1 (9)
- IKBKB (9)
- ATF4 (8)
- DDIT3 (8)
- MEF2C (8)
- NFKB2 (8)
- NR4A1 (8)
- RPS6KA5 (8)
- JUND (7)
- MECOM (7)
- NFATC4 (7)
- SRF (7)
- NFATC2 (5)
- TGFB1 (5)
- MAP2K3 (4)
- MAX (4)
- PPP3CB (4)
- CRK (3)
- DAXX (3)
- ELK4 (3)
- NLK (3)
- RPS6KA4 (3)
- TNFRSF1A (3)
- FGF10 (2)
- MAP3K13 (2)
- TNF (2)
- PPP5C (1)