Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit monoclonal antibody against Phospho Tuberin (pS939)(EP1062Y) (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Phospho-specific |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit Polyclonal p70 S6 Kinase (Thr389/412) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p70 S6 Kinase around the phosphorylation site of Threonine 389/412 |
| Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT2 |
VEGFB Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VEGFB |
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit anti-PDPK1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human PDPK1 |
Rabbit anti-VEGFA Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VEGFA |
Rabbit Polyclonal Anti-VEGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGF Antibody: Synthetic peptide corresponding to a region derived human vascular endothelial growth factor A |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
| Modifications | Phospho-specific |
Anti-PRKAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N terminal 14 amino acids of human protein kinase, AMP-activated, alpha 1 catalytic subunit |
Rabbit polyclonal AKT2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2. |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PI3-kinase p85- alpha/ gamma (Tyr467/199) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha/ gamma around the phosphorylation site of Tyrosine 467/199 |
| Modifications | Phospho-specific |
Rabbit polyclonal p90 RSK (Ab-573) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p90 RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C). |
Rabbit polyclonal p90 RSK (Phospho-Thr573) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human P90RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C). |
| Modifications | Phospho-specific |
Phospho-AKT1-S473 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S473 of human AKT1 |
| Modifications | Phospho-specific |
Phospho-AKT1-T308 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T308 of human AKT1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-AKT1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1/3 Antibody: A synthesized peptide derived from human AKT1/3 |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-AKT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKT1 Antibody: A synthesized peptide derived from human AKT1 |
Rabbit Polyclonal Anti-VEGFB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VEGFB Antibody: A synthesized peptide derived from human VEGFB |
Rabbit Polyclonal Anti-IGF1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1 |
Rabbit Polyclonal Anti-PI3-kinase p85-alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI3-kinase p85-alpha Antibody: A synthesized peptide derived from human PI3-kinase p85-alpha |
Germany
Japan
United Kingdom
China
