Rabbit polyclonal anti-SSH3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SSH3. |
Rabbit polyclonal anti-SSH3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SSH3. |
Rabbit polyclonal anti-ILKAP antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ILKAP. |
Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN. |
Modifications | Phospho-specific |
Rabbit polyclonal SSH3 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SSH3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 575-602 amino acids from the C-terminal region of human SSH3. |
Rabbit polyclonal PTP4A2 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PTP4A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-59 amino acids from the Central region of human PTP4A2. |
Rabbit polyclonal CTDSP1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CTDSP1. |
Rabbit polyclonal SHP-1 (Phospho-Tyr564) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SHP-1 around the phosphorylation site of tyrosine 564 (D-V-YP-E-N). |
Modifications | Phospho-specific |
Rabbit polyclonal DUSP16 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DUSP16. |
Rabbit Polyclonal Phospho-SHP-1 (Tyr536) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human SHP-1 around the phosphorylation site of Tyrosine 536 |
Modifications | Phospho-specific |
Rabbit Polyclonal PTP1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human PTP1B |
Rabbit Polyclonal Anti-PTPN21 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPN21 antibody is: synthetic peptide directed towards the C-terminal region of Human PTPN21. Synthetic peptide located within the following region: FWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNTVTYGRFKITT |
Rabbit polyclonal Anti-SET Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Rabbit Polyclonal Anti-EWSR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ |
Rabbit Polyclonal Anti-PPP4C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP4C antibody: synthetic peptide directed towards the middle region of human PPP4C. Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: ANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFID |
Rabbit Polyclonal Anti-DUSP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP5 antibody: synthetic peptide directed towards the middle region of human DUSP5. Synthetic peptide located within the following region: AGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATS |
Rabbit Polyclonal Anti-EYA3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EYA3 antibody is: synthetic peptide directed towards the middle region of Human EYA3. Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN |
Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ |
Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL |
Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA |
Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK |
Rabbit Polyclonal Anti-PPM1B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPM1B antibody: synthetic peptide directed towards the N terminal of human PPM1B. Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN |
Rabbit Polyclonal Anti-PPM1A Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPM1A antibody: synthetic peptide directed towards the middle region of human PPM1A. Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK |
Rabbit Polyclonal Anti-MTMR14 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTMR14 antibody: synthetic peptide directed towards the middle region of human MTMR14. Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS |
Rabbit Polyclonal Anti-PDP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV |
Rabbit Polyclonal Anti-PDP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDP2 antibody: synthetic peptide directed towards the middle region of human PDP2. Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED |
Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL |
Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK |
Rabbit Polyclonal Anti-CYP2A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2A7 antibody: synthetic peptide directed towards the middle region of human CYP2A7. Synthetic peptide located within the following region: KVEHNQRTLDPNSPQDFIDSFLIHMQEEEKNPNTEFYLKNLMMSTLNLFI |
Rabbit Polyclonal Anti-ACPP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACPP antibody: synthetic peptide directed towards the middle region of human ACPP. Synthetic peptide located within the following region: CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV |
Rabbit Polyclonal Anti-ACP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the middle region of human ACP1. Synthetic peptide located within the following region: NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA |
Rabbit Polyclonal Anti-PPP2R3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETA |
Rabbit Polyclonal Anti-PPP2R3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP2R3B antibody: synthetic peptide directed towards the C terminal of human PPP2R3B. Synthetic peptide located within the following region: ELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQ |
Rabbit Polyclonal Anti-PTP4A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTP4A3 antibody: synthetic peptide directed towards the C terminal of human PTP4A3. Synthetic peptide located within the following region: MKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
Rabbit Polyclonal Anti-SHPS1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1 |
Rabbit Polyclonal Anti-PTPN22 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22 |
Rabbit Polyclonal Anti-DUSP16 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP16 Antibody: A synthesized peptide derived from human DUSP16 |
Rabbit Polyclonal Anti-ILKAP Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ILKAP Antibody: A synthesized peptide derived from human ILKAP |
Rabbit Polyclonal Anti-Phospho-CDC25A(Ser75) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CDC25A(Ser75) Antibody: A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75 |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829) |
Rabbit Polyclonal antibody to MTMR9 (myotubularin related protein 9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 487 and 549 of MTMR9 (Uniprot ID#Q96QG7) |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit polyclonal antibody to PPEF1 (protein phosphatase, EF-hand calcium binding domain 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 201 of PPEF-1 (Uniprot ID#O14829) |
Rabbit polyclonal anti-PPP1R7 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R7. |
Rabbit polyclonal CDC25B (Ser323) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25B around the phosphorylation site of serine 323 (S-P-SP-M-P). |
Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ab-178) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
Rabbit polyclonal anti-PPP2R5A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A. |
Rabbit polyclonal anti-CC14A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CC14A. |
Rabbit polyclonal anti-PPM1L antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPM1L. |
Rabbit polyclonal anti-PP4R2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PP4R2. |