SNAP25 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SNAP25 |
SNAP25 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SNAP25 |
Rabbit Polyclonal VAMP7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7. |
Rabbit Polyclonal Anti-CAT Antibody - middle region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
Rabbit Polyclonal Anti-MDS032 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D) |
Modifications | Phospho-specific |
Rabbit polyclonal SNAP25 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human SNAP25. |
Rabbit Polyclonal Anti-C1orf142 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA |
Rabbit Polyclonal Anti-USE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL |
Rabbit Polyclonal Anti-SNAP23 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC |
Rabbit Polyclonal Anti-SNAP25 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNAP25 Antibody: A synthesized peptide derived from human SNAP25 |
Rabbit Polyclonal Anti-VTI1a Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a. |
Rabbit Polyclonal antibody to Syntaxin 5 (syntaxin 5)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 307 of Syntaxin 5 (Uniprot ID#Q13190) |
Rabbit polyclonal anti-VTI1B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human VTI1B. |
Rabbit polyclonal anti-VTI1A antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VTI1A. |
Rabbit Polyclonal Syntaxin 1A Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A |
Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14 |
Modifications | Phospho-specific |
Rabbit Polyclonal STX11 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 92 and 297 of Syntaxin 4 (Uniprot ID#Q12846) |
Rabbit Polyclonal Anti-USE1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS |
SNAP25 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human SNAP25 |
Rabbit polyclonal anti-SEC22B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human SEC22B. |
Rabbit Polyclonal Anti-STX1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STX1A antibody: synthetic peptide directed towards the N terminal of human STX1A. Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV |
Rabbit Polyclonal Anti-STX19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STX19 Antibody: synthetic peptide directed towards the N terminal of human STX19. Synthetic peptide located within the following region: LQQAVIYEREPVAERHLHEIQKLQESINNLADNVQKFGQQQKSLVASMRR |
Rabbit Polyclonal Anti-USE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: EKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQT |
Rabbit Polyclonal Anti-VTI1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VTI1A antibody: synthetic peptide directed towards the N terminal of human VTI1A. Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL |
Rabbit Polyclonal Anti-VAMP5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN |
Rabbit Polyclonal Anti-VAMP7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VAMP7 antibody: synthetic peptide directed towards the N terminal of human VAMP7. Synthetic peptide located within the following region: KIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFNFLNEIKK |
Rabbit Polyclonal Anti-GOSR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GOSR1 antibody: synthetic peptide directed towards the C terminal of human GOSR1. Synthetic peptide located within the following region: IHSKMNTLANRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH |
Rabbit Polyclonal Anti-SNAP29 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK |
Rabbit Polyclonal Anti-SNAP29 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP |
Rabbit Polyclonal Anti-STX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the C terminal of human STX4. Synthetic peptide located within the following region: VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV |
Rabbit Polyclonal Anti-STX4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STX4 antibody: synthetic peptide directed towards the middle region of human STX4. Synthetic peptide located within the following region: LKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE |
Rabbit Polyclonal Anti-VAMP8 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Vamp8 antibody is: synthetic peptide directed towards the middle region of Rat Vamp8. Synthetic peptide located within the following region: LDHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVKMIVIICVIVLIILIL |
Rabbit Polyclonal Anti-STX7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STX7 antibody: synthetic peptide directed towards the N terminal of human STX7. Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS |
Rabbit Polyclonal Anti-STX8 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Stx8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stx8. Synthetic peptide located within the following region: IISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRTEARRVTLVDRK |
Rabbit Polyclonal Anti-VAMP1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Vamp1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Vamp1. Synthetic peptide located within the following region: MSAPAQPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRV |
Anti-BNIP1 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1 |
Anti-BNIP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1 |
Anti-STX1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Anti-STX1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Anti-SNAP25 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-SNAP25 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SNAP23 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAP23 |
Rabbit Polyclonal Anti-SNAP29 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SNAP29 |
Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STX7 |
Rabbit Polyclonal Anti-STX8 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STX8 |
Rabbit Polyclonal Anti-STX12 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-STX16 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STX16 |
Rabbit Polyclonal Anti-STX18 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STX18 |
Rabbit Polyclonal Anti-STX10 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human STX10 |