Antibodies

View as table Download

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

Rabbit Polyclonal Antibody against RAC1 (S71)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1.

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Applications IHC, WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Rabbit polyclonal ATP6V1B1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1.

Rabbit Polyclonal antibody to alpha Tubulin 1A (tubulin, alpha 1a)

Applications IF, IHC, WB
Reactivities Human, Mouse, Drosophila, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 37 and 276 of alpha Tubulin 1A

Rabbit polyclonal FOXG1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This FOXG1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 225-252 amino acids from the Central region of human FOXG1.

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Rabbit polyclonal SMAD2 Antibody

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SMAD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 97-125 amino acids from human SMAD2.

Rabbit Polyclonal Calnexin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643]

Rabbit Polyclonal Cdc73 Antibody

Applications WB
Reactivities Drosophila, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Cdc73 antibody: drosophila Cdc73 (Cell division cycle protein 73), using the full length recombinant protein.

Rabbit Polyclonal H3K9me3 Antibody

Applications WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-H3K9me3 antibody: the region of histone H3 containing the trimethylated lysine 9 (H3K9me3).

Rabbit Polyclonal Rtf1 Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen The immunogen for anti-Rtf1 antibody: drosophila Rtf1 (Rtf1, Paf1/RNA polymerase II complex component, homolog), using the full length recombinant protein.

Rabbit Polyclonal Antibody against MAP2K1 (S217)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1).

Rabbit Polyclonal anti-UBB Antibody

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila
Conjugation Unconjugated
Immunogen Native bovine Ubiquitin, conjugated to KLH

Rabbit polyclonal Hsp 90 alpha antibody

Applications WB
Reactivities Chicken, Drosophila, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 289-300 of human Hsp90 protein.

Rabbit Polyclonal Anti-SOD (Mn) Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Bovine, Canine, Chicken, Dosophila, Guinea Pig, Pig, Hamster, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen Rat Mn SOD

Rabbit Polyclonal Antibody against HSPA1A (Y41)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPA1A/HSPA1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-48 amino acids from human HSPA1A/HSPA1B.

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit Polyclonal anti-CANX Antibody

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Anti-Erk1/2 Antibody

Applications IF, WB
Reactivities Chicken, Drosophila, Human, Mouse, Rat, Sheep, Xenopus, Cow
Conjugation Unconjugated
Immunogen A 35 residue synthetic peptide, corresponding to Erk1 MAP kinase with the CGG spacer group added and the peptide coupled to KLH.

Rabbit Polyclonal TRPM8 Antibody

Applications IHC, WB
Reactivities Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptides made to residues 278-292 RNQLEKYISERTIQD and the C-terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein.

Rabbit Polyclonal RNA Polymerase II/POLR2A [p Thr4] Antibody

Applications Dot, WB
Reactivities Human, Chicken, Drosophila, Yeast
Conjugation Unconjugated
Immunogen A synthetic peptide made to a phosphorylated Threonine (position 4) of the CTD heptad in the human RNA polymerase II protein [UniProt P24928]

Rabbit Polyclonal anti-CANX Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus
Conjugation Unconjugated
Immunogen Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit Polyclonal Ubiquitin Antibody

Applications IF
Reactivities Bovine, C. elegans, Chicken, Drosophila, Human, Mouse
Conjugation Unconjugated
Immunogen Gluteraldehyde cross-linked ubiquitin.

Rabbit polyclonal anti-CASZ1 antibody

Applications WB
Reactivities Human, Mouse, Drosophila, Chimpanzee and Macaque
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human Casz1 protein.

Rabbit Polyclonal Anti-Calnexin -CT Antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak)
Conjugation Unconjugated
Immunogen Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues.

Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1.

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications WB
Reactivities Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa
Conjugation Unconjugated
Immunogen Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen.

Rabbit Polyclonal MEK1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Drosophila
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250, containing phospho serine residues at positions 218 and 222, of human MEK1 was used as the immunogen.

Rabbit anti TK1 (Thymidine Kinase) Polyclonal Antibody

Applications WB
Reactivities Drosph
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of fruit fly thymidine kinase protein.

Rabbit Polyclonal Anti-beta-Actin Antibody (biotin)

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Biotin-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin.

Rabbit Polyclonal Anti-beta-Actin Antibody (HRP)

Applications WB
Reactivities Chicken, Drosophila, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen HRP-Beta-Actin antibody was raised against a synthetic peptide containing 16 amino acids near the amino terminus of beta-actin.

Antp Antibody - C-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

eve Antibody - N-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

cad Antibody - middle region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

prd Antibody - middle region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

exd Antibody - C-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

hb Antibody - N-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a middle region of Drosophila hb_x000D_

lab Antibody - N-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

pb Antibody - middle region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated

ac Antibody - N-terminal region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

Anti-AKT (Thr342) Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr342 of Drosophila AKT, conjugated to keyhole limpet hemocyanin (KLH)

Anti-p70 S6 Kinase (Ser398) Antibody

Applications WB
Reactivities Drosophila
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr398 of Drosophila p70 S6K protein, conjugated to keyhole limpet hemocyanin (KLH).