Antibodies

View as table Download

CA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CA3

Rabbit anti-GLUL Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLUL

Rabbit anti-ASNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ASNS

Rabbit anti-CA1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CA1

Rabbit Polyclonal GLS2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GLS2 antibody was raised against a 18 amino acid synthetic peptide near the center terminus of human GLS2.

Rabbit polyclonal GLS Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS.

Rabbit Polyclonal GLS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Rabbit polyclonal anti-CA3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA3.

Rabbit polyclonal anti-CA5B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA5B.

Rabbit polyclonal anti-CA14 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CA14.

Anti-CA14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV

Glutamine Synthetase (GLUL) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated

Anti-GLUL Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF

Rabbit Polyclonal Antibody against Glutamine Synthase

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein.

Rabbit Polyclonal Anti-GLS Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLS antibody: synthetic peptide directed towards the c terminal of human GLS. Synthetic peptide located within the following region: VNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQT

Rabbit Polyclonal Anti-CA2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH

Rabbit Polyclonal Anti-ASNS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR

Anti-CA14 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV

Anti-CA3 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3

Anti-CA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 260 amino acids of Human Carbonic anhydrase 3

Anti-CA4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

Anti-CA4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 19-284 amino acids of Human Carbonic anhydrase 4

Anti-CA2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CA1 Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-CA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-ASNS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ASNS

Rabbit Polyclonal Anti-GLUL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GLUL

Rabbit Polyclonal Anti-GLS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GLS