IKBKE Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKE |
IKBKE Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKE |
Rabbit anti-CHUK Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CHUK |
Rabbit Polyclonal RIPK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RIPK1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human RIPK1. |
IKBKB Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human IKBKB |
TBK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TBK1 |
Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal RIP3/RIPK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 497-522 (isoform CRA_a, 518 amino acids) and 298-335 (isoform CRA_b, 319 amino acids) of human RIP3 was used as immunogen for this antibody. |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit Polyclonal IKK-alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-alpha |
Rabbit Polyclonal IKK-alpha/beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta |
Rabbit Polyclonal IKK-alpha/beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-alpha/beta |
Rabbit Polyclonal IKK- alpha (Ser176) /IKK- beta (Ser177) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- alpha /IKK- beta around the phosphorylation site of Serine 177 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK- alpha (Thr23) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- alpha around the phosphorylation site of Threonine 23 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK- alpha/ beta (Ser180/181) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- alpha/ beta around the phosphorylation site of Serine 180/181 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-beta Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-beta Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit Polyclonal IKK alpha Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK alpha antibody was raised against a 19 amino acid peptide near the carboxy terminus of human IKK alpha. The immunogen is located within the last 50 amino acids of IKK alpha. |
Rabbit Polyclonal IKK alpha Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK alpha antibody was raised against a peptide corresponding to amino acids 699 to 715 of human IKK alpha, which differs from corresponding murine sequence by one amino acid . |
Rabbit Polyclonal IKK alpha Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK alpha antibody was raised against a peptide corresponding to amino acids 658 to 674 of human IKK alpha, which differs from corresponding murine sequence by one amino acid. |
Rabbit Polyclonal IKK beta Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK beta antibody was raised against a peptide corresponding to amino acids near the carboxy-terminus of human IKK beta (Genbank accession NoO14920), which differs from corresponding murine sequence by one amino acid. |
Rabbit Polyclonal IKK epsilon Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | IKK epsilon antibody was raised against a peptide corresponding to amino acids 701 to 716 of human IKK epsilon/IKK-i. |
Rabbit polyclonal anti-IKK beta antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKKb peptide corresponding to the highly conserved C-terminus region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Anti-CHUK (Phospho-Thr23) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of threonine 23 (L-G-T(p)-G-G) derived from Human IKK a. |
Modifications | Phospho-specific |
Anti-CHUK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.21~25 (L-G-T-G-G) derived from Human IKK a. |
Rabbit Polyclonal NAK Antibody
Applications | IF |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NAK antibody was raised against a synthetic peptide corresponding to 17 amino acids form near the carboxy terminus of human NAK/TBK1. |
Rabbit polyclonal IKK alpha antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IKK a peptide corresponding to the highly conserved C-terminus region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Rabbit Polyclonal RIP1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RIP1 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human RIP1. |
Rabbit Polyclonal Anti-RIPK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RIPK1 antibody: synthetic peptide directed towards the middle region of human RIPK1. Synthetic peptide located within the following region: RRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQ |
Phospho-IKBKB-Y199 Rabbit Polyclonal Antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y199 of human IKBKB |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the N terminal of human TBK1. Synthetic peptide located within the following region: EEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVVGGM |
Rabbit Polyclonal Anti-TBK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBK1 antibody: synthetic peptide directed towards the middle region of human TBK1. Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ |
Rabbit anti I-Kappa-B Kinase b (IKKb) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The full length of human IKKβ recombinant protein. |
Rabbit anti IKK-alpha Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti IKK-a (pS176/180) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding of –QGSLCTS-of human IKK-a/β protein with a single phosphorylation site. This sequence is identical to human, rat, mouse and bovine. |
Rabbit anti IKK-b (pY199) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti IKK-b (CT) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti IKK-a (Paired 176/180) Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IKBKE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKE |
Rabbit Polyclonal Anti-CHUK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CHUK |
Rabbit Polyclonal Anti-IKBKB Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IKBKB |
Rabbit Polyclonal anti-IKBKB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKB |
Rabbit Polyclonal anti-IKBKB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKB |