Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Caldesmon (CALD1) rabbit monoclonal antibody, clone EP19, Supernatant
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Rabbit polyclonal Bcl-6 (Ser333) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-BCL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-BCL6 antibody is: synthetic peptide directed towards the C-terminal region of Human BCL6. Synthetic peptide located within the following region: IHTGEKPYHCEKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPP |
Calponin (CNN1) rabbit monoclonal antibody, clone EP798Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
CD14 rabbit monoclonal antibody, clone EPR3653, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
Complement C3 (C3) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding to C3d |
bcl 6 (BCL6) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 675-704 amino acids from the C-terminal region of human BCL6 |
Rabbit Polyclonal BCL6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BCL6 antibody was raised against an 18 amino acid synthetic peptide near the center of human BCL6. |
MUC16 rabbit monoclonal antibody, clone EPR1020(2), Purified
Applications | IHC |
Reactivities | Human |
Rabbit polyclonal Bcl-6 (Ab-333) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bcl-6 around the phosphorylation site of serine 333 (P-Q-SP-P-Q). |
Rabbit anti BCL-6 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BCL6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BCL6 |