Antibodies

View as table Download

Rabbit anti-SFN Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFN

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.

Rabbit polyclonal anti-TGF beta2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β2.

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.

TGF beta 3 (TGFB3) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the C-terminus of the precursor form of human TGF beta 3

Rabbit anti-TGFB1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 366 of human TGF-β2

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-Tgfb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human TGF-β2

Rabbit polyclonal TGF beta 1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length).

Rabbit polyclonal SFN Antibody (Center)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This SFN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human SFN.

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the N terminal of human SFN. Synthetic peptide located within the following region: VVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL

Rabbit Polyclonal Anti-SFN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFN antibody: synthetic peptide directed towards the middle region of human SFN. Synthetic peptide located within the following region: FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT

Rabbit anti TGF-beta 2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein.

Rabbit anti TGF beta Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human TGF-beta protein.

Rabbit anti TGF beta 1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A Recombinant protein encoding human TGF beta 1 aa 177-391 expressed in E.Coli.

Anti-TGFB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-278 amino acids of human transforming growth factor, beta 1

Rabbit Polyclonal Anti-TGFB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TGFB2

TGFB2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2

TGFB3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

TGFB3 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

Rabbit polyclonal anti-TGFB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TGFB2

Rabbit polyclonal anti-TGFB2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TGFB2