Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
View as table Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
USD 380.00
In Stock
Rabbit Polyclonal Anti-AMH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG |
Rabbit Polyclonal Anti-IL-12A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A. |
Rabbit Polyclonal Anti-Interleukin 12A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A |
Anti-Human BCA-1 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human BCA-1 (CXCL13) |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit Polyclonal IL-1RAcP Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-1RAcP antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of IL-1RAcP, which differs from the sequence of mouse origin by three amino acids. |
Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CXCL1 (KC) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 78 of mouse KC |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
IL2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL2 |
IL1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1A |
Rabbit anti-IL28B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL28B |
Rabbit anti-TNFSF13B Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF13B |
Rabbit Polyclonal Anti-GRO alpha
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRO alpha: A synthesized peptide derived from human GRO alpha |
Active filters
Reactivities
- Human
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (49)
- AMH (36)
- FLT1 (11)
- EPOR (10)
- IL4 (10)
- CCL2 (9)
- TNFRSF11B (9)
- TNFSF13 (9)
- LEP (8)
- TGFB2 (8)
- TNF (8)
- VEGFA (8)
- EDA (7)
- IFNG (7)
- IL2 (7)
- TGFB1 (7)
- TNFRSF1B (7)
- VEGFB (7)
- CD40 (6)
- CSF1 (6)
- CX3CL1 (6)
- CXCL1 (6)
- CXCL12 (6)
- FAS (6)
- FASLG (6)
- IL17A (6)
- IL7 (6)
- IL9 (6)
- TNFRSF1A (6)
- CSF2 (5)
- CSF2RA (5)
- CSF3 (5)
- CXCL14 (5)
- IFNB1 (5)
- IL12A (5)
- IL1B (5)
- IL21 (5)
- IL3 (5)
- INHBA (5)
- PRL (5)
- TNFSF13B (5)
- BMP2 (4)
- CCL28 (4)
- CTF1 (4)
- CXCL13 (4)
- CXCL8 (4)
- EPO (4)
- GH2 (4)
- IFNL3 (4)
- IL10 (4)
- IL15 (4)
- IL15RA (4)
- IL1A (4)
- IL20 (4)
- IL5 (4)
- IL6 (4)
- IL6ST (4)
- LIF (4)
- TGFB3 (4)
- BMP7 (3)
- CCL1 (3)
- CCL11 (3)
- CCL17 (3)
- CCL20 (3)
- CCL21 (3)
- CCL23 (3)
- CCL5 (3)
- CCL8 (3)
- CD40LG (3)
- CRLF2 (3)
- CXCL10 (3)
- CXCL16 (3)
- CXCL3 (3)
- CXCL5 (3)
- CXCL6 (3)
- IL11 (3)
- IL13 (3)
- IL18 (3)
- IL19 (3)
- IL1RAP (3)
- IL22 (3)
- IL22RA2 (3)
- IL23A (3)
- IL24 (3)
- IL4R (3)
- INHBC (3)
- OSM (3)
- TNFRSF6B (3)
- CCL13 (2)
- CCL16 (2)
- CCL19 (2)
- CCL7 (2)
- CSF3R (2)
- CXCL11 (2)
- CXCL2 (2)
- CXCL9 (2)
- FLT3LG (2)
- GH1 (2)
- IFNA16 (2)
- IFNA2 (2)