Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit polyclonal anti-PCNA antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PCNA |
Rabbit Polyclonal PCNA Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit anti-RAD23A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAD23A |
Rabbit anti-ERCC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ERCC1 |
Rabbit Polyclonal Anti-Cyclin H Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cyclin H Antibody: A synthesized peptide derived from human Cyclin H |
Rabbit Polyclonal Anti-PCNA Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCNA Antibody: A synthesized peptide derived from human PCNA |
Rabbit Polyclonal Anti-TF2H2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TF2H2 Antibody: A synthesized peptide derived from human TF2H2 |
Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249) |
Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927) |
Rabbit polyclonal anti-RFC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFC2. |
Rabbit polyclonal anti-TF2H2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H2. |
Rabbit polyclonal anti-MAT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MAT1. |
Rabbit polyclonal anti-RAD23B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human RAD23B. |
Rabbit polyclonal anti-POLD1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Anti-RPA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human replication protein A1, 70kDa |
Rabbit polyclonal POLE3 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This POLE3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 5-34 amino acids from the N-terminal region of human POLE3. |
Rabbit polyclonal RFA2 (Ser33) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of serine 33 (A-P-SP-Q-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-POLD3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD3. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Fish, Human, Monkey, Mouse, Rat, Xenopus, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
Anti-XPA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ERCC3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 270 amino acids of human excision repair cross-complementing rodent repair deficiency, complementation group 3 |
Anti-MNAT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal POLD2 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Rabbit polyclonal Anti-Rfc1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG |
Anti-CUL4A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 720-734 amino acids of Human cullin 4A |
Anti-PCNA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-DDB1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1125-1140 amino acids of Human DNA damage-binding protein 1 |
Active filters
Reactivities
- Rat
Antibody Hosts
- Rabbit
Pathways
- Nucleotide excision repair