Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-SMARCA5 antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Rabbit Polyclonal Anti-CTCF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit Polyclonal Anti-SRF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |
Rabbit Polyclonal Anti-TAF12 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF12 antibody: synthetic peptide directed towards the N terminal of human TAF12. Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL |
Rabbit Polyclonal Anti-FBXO11 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXO11 antibody: synthetic peptide directed towards the middle region of human FBXO11. Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ |
Rabbit Polyclonal Anti-TAF1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the middle region of human TAF1. Synthetic peptide located within the following region: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE |
Rabbit Polyclonal Anti-EHMT2 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EHMT2 antibody: synthetic peptide directed towards the N terminal of human EHMT2. Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG |
Rabbit polyclonal Anti-MED19 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED19 antibody is: synthetic peptide directed towards the middle region of Human MED19. Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH |
Rabbit Polyclonal Anti-Hdac4 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Rabbit Polyclonal Anti-MED6 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN |
Rabbit Polyclonal Anti-MED6 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV |
Rabbit Polyclonal Anti-EZH1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EZH1 Antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK |
Rabbit Polyclonal Anti-HIST2H2BF Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH |
Rabbit Polyclonal Anti-MBD4 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
Rabbit Polyclonal Anti-Thrb Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Rabbit Polyclonal Anti-Thrb Antibody
| Applications | Assay, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
Rabbit Polyclonal Anti-TAF6 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the C terminal of human TAF6. Synthetic peptide located within the following region: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP |
MHC Class I H2 Dk mouse monoclonal antibody, clone H100-30/23, Ascites
| Applications | Assay |
| Reactivities | Mouse |
Mouse Monoclonal ER alpha Antibody
| Applications | Assay |
| Reactivities | Human |
Mouse Monoclonal EZH2 Antibody
| Applications | Assay |
| Reactivities | Human, Mouse |
USD 420.00
4 Weeks
USD 420.00
5 Days
Active filters
Applications
- Assay
Filter by
Target Symbol
- MS4A1 (9)
- HIST1H3A (7)
- CD8A (6)
- BTN3A2 (5)
- CXCR4 (5)
- SERPINB3 (5)
- TP53 (5)
- THY1 (4)
- CD5 (3)
- POLR2A (3)
- CTNNB1 (2)
- EGFR (2)
- ESR1 (2)
- HDAC2 (2)
- HDAC6 (2)
- HIS (2)
- MED6 (2)
- SMARCA1 (2)
- TAF1 (2)
- THRB (2)
- ABCD3 (1)
- ACETYL-HISTONE H3 (LYS14) (1)
- ACETYL-HISTONE H3 (LYS18) (1)
- ACETYL-HISTONE H3 (LYS27) (1)
- ACETYL-HISTONE H3 (LYS36) (1)
- ACETYL-HISTONE H3 (LYS4) (1)
- ACETYL-HISTONE H3 (LYS9) (1)
- ACETYLATED -LYSINE (1)
- ADGRE1 (1)
- AGL (1)
- AK6 (1)
- ALOX5AP (1)
- AMBP (1)
- BST2 (1)
- CCND1 (1)
- CD4 (1)
- CEACAM5 (1)
- CLEC1B (1)
- CTCF (1)
- CYP26C1 (1)
- DIMETHYL-HISTONE H3 (LYS14) (1)
- DIMETHYL-HISTONE H3 (LYS36) (1)
- DIMETHYL-HISTONE H3 (LYS4) (1)
- DIMETHYL-HISTONE H3 (LYS79) (1)
- DIMETHYL-HISTONE H3 (LYS9) (1)
- DYM (1)
- EEF1G (1)
- EHMT2 (1)
- EZH1 (1)
- EZH2 (1)
- FBXO11 (1)
- FCAR (1)
- GAPDH (1)
- GYS1 (1)
- H2-Q6 (1)
- H2AFZ (1)
- H2BC18 (1)
- HDAC1 (1)
- HDAC4 (1)
- IL11RA (1)
- IL13RA1 (1)
- ITGAV (1)
- JUN (1)
- KLF2 (1)
- KLKB1 (1)
- LY75-CD302 (1)
- MBD4 (1)
- MCM7 (1)
- MED17 (1)
- MED19 (1)
- MONOMETHYL-HISTONE H3 (LYS4) (1)
- MONOMETHYL-HISTONE H3 (LYS79) (1)
- MONOMETHYL-HISTONE H3 (LYS9) (1)
- MYC (1)
- NR3C1 (1)
- OCM2 (1)
- OGA (1)
- PADI4 (1)
- PAX8 (1)
- PHOSPHOTHREONINE (1)
- POT1 (1)
- PRKCG (1)
- RETN (1)
- S100B (1)
- SKP1 (1)
- SMARCA5 (1)
- SRF (1)
- STC1 (1)
- SUZ12 (1)
- TAF12 (1)
- TAF6 (1)
- TBP (1)
- TGFB1 (1)
- TRIMETHYL-HISTONE H3 (LYS27) (1)
- TRIMETHYL-HISTONE H3 (LYS36) (1)
- TRIMETHYL-HISTONE H3 (LYS4) (1)
- TY1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Families
- Druggable Genome (73)
- Transcription Factors (35)
- Transmembrane (30)
- ES Cell Differentiation/IPS (14)
- Secreted Protein (11)
- Stem cell - Pluripotency (10)
- GPCR (5)
- Protein Kinase (5)
- Nuclear Hormone Receptor (4)
- Stem cell relevant signaling - JAK/STAT signaling pathway (4)
- Adult stem cells (3)
- Cancer stem cells (2)
- Stem cell relevant signaling - DSL/Notch pathway (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Protease (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
Pathways
- Pathways in cancer (19)
- Cell cycle (13)
- Colorectal cancer (13)
- Huntington's disease (12)
- MAPK signaling pathway (12)
- Wnt signaling pathway (12)
- Chronic myeloid leukemia (11)
- Endometrial cancer (11)
- Hematopoietic cell lineage (11)
- Cytokine-cytokine receptor interaction (10)
- Prostate cancer (10)
- Thyroid cancer (10)
- Bladder cancer (9)
- Glioma (9)
- Non-small cell lung cancer (9)
- Pancreatic cancer (9)
- Systemic lupus erythematosus (9)
- Focal adhesion (8)
- Leukocyte transendothelial migration (8)
- Melanoma (8)
- Small cell lung cancer (8)
- Basal cell carcinoma (7)
- Endocytosis (7)
- Neurotrophin signaling pathway (6)
- p53 signaling pathway (6)
- Amyotrophic lateral sclerosis (ALS) (5)
- Apoptosis (5)
- Axon guidance (5)
- Basal transcription factors (5)
- Chemokine signaling pathway (5)
- ErbB signaling pathway (5)
- Metabolic pathways (5)
- Adherens junction (4)
- Jak-STAT signaling pathway (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Calcium signaling pathway (3)
- Epithelial cell signaling in Helicobacter pylori infection (3)
- Gap junction (3)
- GnRH signaling pathway (3)
- Melanogenesis (3)
- Notch signaling pathway (3)
- Purine metabolism (3)
- Pyrimidine metabolism (3)
- RNA polymerase (3)
- Regulation of actin cytoskeleton (3)
- TGF-beta signaling pathway (3)
- Tight junction (3)
- Acute myeloid leukemia (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Neuroactive ligand-receptor interaction (2)
- Pathogenic Escherichia coli infection (2)
- Renal cell carcinoma (2)
- Starch and sucrose metabolism (2)
- ABC transporters (1)
- Alzheimer's disease (1)
- B cell receptor signaling pathway (1)
- Base excision repair (1)
- Cell adhesion molecules (CAMs) (1)
- Complement and coagulation cascades (1)
- DNA replication (1)
- ECM-receptor interaction (1)
- Fc gamma R-mediated phagocytosis (1)
- Glycolysis / Gluconeogenesis (1)
- Insulin signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Natural killer cell mediated cytotoxicity (1)
- Oocyte meiosis (1)
- Phosphatidylinositol signaling system (1)
- Retinol metabolism (1)
- T cell receptor signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)