Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal anti-TP53 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-SMARCA5 antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCA5 antibody: synthetic peptide directed towards the N terminal of human SMARCA5. Synthetic peptide located within the following region: AGPADAEMEEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTE |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS |
Rabbit Polyclonal Anti-CTNNB1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Rabbit Polyclonal Anti-CTCF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTCF antibody: synthetic peptide directed towards the N terminal of human CTCF. Synthetic peptide located within the following region: GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEE |
Rabbit Polyclonal Anti-SRF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SRF antibody: synthetic peptide directed towards the N terminal of human SRF. Synthetic peptide located within the following region: ATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIM |
Rabbit Polyclonal Anti-TAF12 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF12 antibody: synthetic peptide directed towards the N terminal of human TAF12. Synthetic peptide located within the following region: MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRL |
Rabbit Polyclonal Anti-FBXO11 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBXO11 antibody: synthetic peptide directed towards the middle region of human FBXO11. Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ |
Rabbit Polyclonal Anti-TAF1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the middle region of human TAF1. Synthetic peptide located within the following region: MMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEE |
Rabbit Polyclonal Anti-EHMT2 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EHMT2 antibody: synthetic peptide directed towards the N terminal of human EHMT2. Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG |
Rabbit polyclonal Anti-MED19 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED19 antibody is: synthetic peptide directed towards the middle region of Human MED19. Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH |
Rabbit Polyclonal Anti-Hdac4 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hdac4 Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac4. Synthetic peptide located within the following region: SSTVGHSLIEAQKCEKEEAETVTAMASLSVGVKPAEKRSEEEPMEEEPPL |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: ALLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKN |
Rabbit Polyclonal Anti-MED6 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED6 Antibody: synthetic peptide directed towards the middle region of human MED6. Synthetic peptide located within the following region: LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV |
Rabbit Polyclonal Anti-EZH1 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EZH1 Antibody: synthetic peptide directed towards the N terminal of human EZH1. Synthetic peptide located within the following region: VDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKK |
Rabbit Polyclonal Anti-HIST2H2BF Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HIST2H2BF Antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF. Synthetic peptide located within the following region: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVH |
Rabbit Polyclonal Anti-MBD4 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT |
Rabbit Polyclonal Anti-Thrb Antibody
Applications | Assay, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the N terminal of mouse Thrb. Synthetic peptide located within the following region: KSKDSDLDMALSQSSQPAHLPEEKPFPQVQSPPHSQKKGYIPSYLDKDEL |
Rabbit Polyclonal Anti-Thrb Antibody
Applications | Assay, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrb antibody: synthetic peptide directed towards the n terminal of mouse Thrb. Synthetic peptide located within the following region: MNYCMPEVHEVCPAASSNCYMQVTDYLAYLEDSPALSGRDVQAVPSSSIY |
Rabbit Polyclonal Anti-TAF6 Antibody
Applications | Assay, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF6 antibody: synthetic peptide directed towards the C terminal of human TAF6. Synthetic peptide located within the following region: PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP |
MHC Class I H2 Dk mouse monoclonal antibody, clone H100-30/23, Ascites
Applications | Assay |
Reactivities | Mouse |
Mouse Monoclonal ER alpha Antibody
Applications | Assay |
Reactivities | Human |
Mouse Monoclonal EZH2 Antibody
Applications | Assay |
Reactivities | Human, Mouse |
Mouse Monoclonal TBP Antibody
Applications | Assay |
Reactivities | Human |
Carrier-free (BSA/glycerol-free) BTN3A2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB3 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | Assay, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Anti-BTN3A2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-BTN3A2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), Biotinylated
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-BTN3A2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6), HRP conjugated
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-BTN3A2 mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
SERPINB3 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | Assay, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
SERPINB3 mouse monoclonal antibody, clone 3C2, Biotinylated
Applications | Assay, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Biotin |
SERPINB3 mouse monoclonal antibody, clone 3C2, HRP conjugated
Applications | Assay, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | HRP |
SERPINB3 mouse monoclonal antibody, clone OTI3C2 (formerly 3C2)
Applications | Assay, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |