Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit polyclonal PROX1 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PROX1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 492-522 amino acids from the C-terminal region of human PROX1. |
Rabbit Polyclonal anti-GATA6 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the middle region of human GATA6. Synthetic peptide located within the following region: SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS |
Rabbit Polyclonal Anti-GATA6 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA6 antibody: synthetic peptide directed towards the N terminal of human GATA6. Synthetic peptide located within the following region: PEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTR |
Mouse Monoclonal OCT4 Antibody (7E7)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TA336803 is a replacement of AM06533SU-N.
Mouse Monoclonal CDX2 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
GATA4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal IPF Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF. |
Mouse Monoclonal Smad2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S). |
c-Myc (MYC) pSer62 rabbit polyclonal antibody, Aff - Purified
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myc around the phosphorylation site of Serine 62(P-L-Sp-P-S). |
PROX1 (C-term) rabbit polyclonal antibody, Biotin
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Recombinant highly conserved C-terminal part of the homeobox transcription factor Human Prox1 (homeo domain and prospero domain) (Cat.-No DA3565). |
Rabbit Polyclonal Gli1 Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made toward the C-terminus portion of the human Gli1 protein (between residues 800-850) [UniProt P08151] |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IF
Families
- Embryonic stem cells
Filter by
Category
Target Symbol
- FGF21 (38)
- MYC (33)
- SMAD2 (15)
- CDX2 (13)
- GATA4 (12)
- CD44 (11)
- POU5F1 (10)
- BMP4 (8)
- FOXA2 (8)
- PDX1 (7)
- GATA6 (6)
- GLI1 (6)
- NANOG (6)
- CD34 (5)
- SOX2 (5)
- KLF4 (4)
- DNMT3B (3)
- SOX9 (3)
- TDGF1 (3)
- BMP2 (2)
- GLI3 (2)
- KIT (2)
- PROX1 (2)
- SMAD3 (2)
- BDNF (1)
- BMP15 (1)
- CD14 (1)
- CD9 (1)
- EGF (1)
- FGF4 (1)
- GLI2 (1)
- IGFBP2 (1)
- KLF5 (1)
- NEUROD1 (1)
- PAX6 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Pathways
- Pathways in cancer (111)
- MAPK signaling pathway (75)
- TGF-beta signaling pathway (60)
- Cell cycle (50)
- Colorectal cancer (50)
- Wnt signaling pathway (50)
- Regulation of actin cytoskeleton (41)
- Melanoma (40)
- Acute myeloid leukemia (37)
- Chronic myeloid leukemia (35)
- Bladder cancer (34)
- Endometrial cancer (34)
- ErbB signaling pathway (34)
- Jak-STAT signaling pathway (33)
- Small cell lung cancer (33)
- Thyroid cancer (33)
- Hematopoietic cell lineage (22)
- Basal cell carcinoma (19)
- Hedgehog signaling pathway (19)
- Pancreatic cancer (18)
- Adherens junction (17)
- Maturity onset diabetes of the young (17)
- ECM-receptor interaction (11)
- Type II diabetes mellitus (7)
- Cell adhesion molecules (CAMs) (5)
- Cytokine-cytokine receptor interaction (5)
- Endocytosis (5)
- Melanogenesis (4)
- Cysteine and methionine metabolism (3)
- Metabolic pathways (3)
- Focal adhesion (1)
- Gap junction (1)
- Glioma (1)
- Huntington's disease (1)
- Neurotrophin signaling pathway (1)
- Non-small cell lung cancer (1)
- Pathogenic Escherichia coli infection (1)
- Prostate cancer (1)
- Toll-like receptor signaling pathway (1)