Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 38 of 38 results

(reset)

Syndecan 4 (SDC4) Rabbit Polyclonal Antibody

TA314520

USD 345.00

In Stock

Rabbit polyclonal Syndecan4 (Ab-179) antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D).

1 / 3

2 / 3

3 / 3

Previous Next

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

TA306659

USD 430.00

In Stock

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4.

1 / 2

2 / 2

Previous Next

CD36 Rabbit Polyclonal Antibody

TA301400

USD 479.00

2 Weeks

Rabbit Polyclonal Antibody against CD36

Applications	IHC, WB
Reactivities	Human, Bovine, Monkey
Conjugation	Unconjugated
Immunogen	A synthetic peptide mapping to a region of human CD36 between residues 100-200.

1 / 3

2 / 3

3 / 3

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: 8E2F3]

TA336769

USD 479.00

5 Days

Mouse Monoclonal CD44 Antibody (8E2F3)

Applications	FC, IHC, WB
Reactivities	Human, Mouse (Does not react with: Rabbit)
Conjugation	Unconjugated

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Integrin alpha 4 (ITGA4) (C-term) Rabbit Polyclonal Antibody

AP23259PU-N

USD 405.00

2 Weeks

Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to the C-terminal of human ITGA4

1 / 2

2 / 2

Previous Next

Integrin alpha 3 (ITGA3) (3A Isoform specific) Mouse Monoclonal Antibody [Clone ID: 29A3]

BM6022P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 29A3, Purified

Applications	IF, IHC, WB
Reactivities	Human

Integrin alpha 3 (ITGA3) (3A Isoform specific) Mouse Monoclonal Antibody [Clone ID: 158A3]

BM6023P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3A Isoform specific) mouse monoclonal antibody, clone 158A3, Purified

Applications	IF, IHC, WB
Reactivities	Canine, Human

1 / 2

2 / 2

Previous Next

Integrin alpha 3 (ITGA3) (3B Isoform specific) Mouse Monoclonal Antibody [Clone ID: 54B3]

BM6025P

USD 390.00

2 Weeks

Integrin alpha 3 (ITGA3) (3B Isoform specific) mouse monoclonal antibody, clone 54B3, Purified

Applications	IF, IHC, WB
Reactivities	Human

CDX2 Rabbit Monoclonal Antibody [Clone ID: EPR2764Y]

AM10075SU-N

USD 550.00

5 Days

CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant

Applications	IF, IHC, WB
Reactivities	Human

Collagen IV (COL4A2) Rabbit Polyclonal Antibody

AP20477PU-N

USD 407.00

2 Weeks

Collagen IV (COL4A2) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

Integrin alpha 6 (ITGA6) (1043-1072) Rabbit Polyclonal Antibody

AP22798PU-N

USD 440.00

2 Weeks

Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6. Epitope: aa 1043-1072

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

AP22982PU-N

USD 440.00

2 Weeks

Integrin alpha 4 (ITGA4) rabbit polyclonal antibody, Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide (GNSAGPKSMEVSC) from (C-term) of human NDRG1

1 / 2

2 / 2

Previous Next

Integrin alpha 6 (ITGA6) (6B Isoform specific) Mouse Monoclonal Antibody [Clone ID: 6B4]

BM6027P

USD 390.00

2 Weeks

Integrin alpha 6 (ITGA6) (6B Isoform specific) mouse monoclonal antibody, clone 6B4, Purified

Applications	IF, IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

Glycoprotein VI (GP6) Rabbit Polyclonal Antibody

TA306632

USD 430.00

5 Days

Rabbit Polyclonal GPVI Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	GPVI antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human GPVI.

1 / 3

2 / 3

3 / 3

Previous Next

CD44 Rabbit Polyclonal Antibody

TA308864

USD 415.00

5 Days

Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Integrin alpha 6 (ITGA6) Rabbit Polyclonal Antibody

TA324731

USD 450.00

5 Days

Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6.

1 / 3

2 / 3

3 / 3

Previous Next

CD49b (ITGA2) Rabbit Polyclonal Antibody

TA338255

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITGA2 Antibody

Applications	IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

1 / 2

2 / 2

Previous Next

Integrin alpha 4 (ITGA4) Rabbit Polyclonal Antibody

TA306654

USD 430.00

5 Days

Rabbit Polyclonal Integrin alpha 4 Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4.

1 / 2

2 / 2

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI3F4]

CF500921

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

CF500935

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI6A5]

CF500954

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF506732

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CD44 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI3F4]

TA500921

USD 379.00

In Stock

Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI3F4]

TA500921S

USD 159.00

2 Days

Anti-CD36 mouse monoclonal antibody, clone OTI3F4 (formerly 3F4)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

TA500935

USD 379.00

In Stock

CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI4H7]

TA500935S

USD 159.00

2 Days

CD36 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI6A5]

TA500954

USD 379.00

In Stock

Anti-CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD36 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A5]

TA500954AM

USD 420.00

5 Days

CD36 mouse monoclonal antibody, clone 6A5, Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD36 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A5]

TA500954BM

USD 420.00

5 Days

CD36 mouse monoclonal antibody, clone 6A5, HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD36 Mouse Monoclonal Antibody [Clone ID: OTI6A5]

TA500954S

USD 159.00

2 Days

Anti-CD36 mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA506732

USD 379.00

In Stock

CD44 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA506732S

USD 159.00

2 Days

CD44 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB133]

UM500098

USD 468.00

In Stock

CD44 mouse monoclonal antibody,clone UMAB133

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB133]

UM500098CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) CD44 mouse monoclonal antibody,clone UMAB133

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB134]

UM500099

USD 468.00

In Stock

CD44 mouse monoclonal antibody,clone UMAB134

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB134]

UM500099CF

USD 528.00

4 Weeks

Carrier-free (BSA/glycerol-free) CD44 mouse monoclonal antibody,clone UMAB134

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB133]

UM570098

USD 180.00

In Stock

CD44 mouse monoclonal antibody,clone UMAB133

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

CD44 Mouse Monoclonal Antibody [Clone ID: UMAB134]

UM570099

USD 180.00

In Stock

CD44 mouse monoclonal antibody,clone UMAB134

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

1 - 38 of 38 results