Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Goat Polyclonal Anti-HTT Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 85 to 200 aa of human HTT produced in E. coli |
USD 380.00
In Stock
Active filters
Reactivities
- Human
Applications
- IHC
Clonalities
- Polyclonal
Availabilities
- In Stock
Filter by
Target Symbol
- AKT1 (8)
- EIF4EBP1 (8)
- PAK1 (7)
- RAB27A (6)
- APAF1 (5)
- ATF2 (5)
- BRAF (5)
- CASP7 (5)
- CASP9 (5)
- DEFA1 (5)
- GCG (5)
- HSPD1 (5)
- JUN (5)
- MUC1 (5)
- NR3C1 (5)
- ADD1 (4)
- ADHFE1 (4)
- AFP (4)
- AKR1B1 (4)
- AMD1 (4)
- BAD (4)
- BAX (4)
- BIRC6 (4)
- CCNB1 (4)
- CCNE1 (4)
- CFLAR (4)
- CLDN7 (4)
- CRMP1 (4)
- CTBP1 (4)
- ERBB3 (4)
- ESR1 (4)
- FHIT (4)
- GEMIN2 (4)
- GNAS (4)
- GPT (4)
- GSK3A (4)
- HDAC1 (4)
- HDAC2 (4)
- INA (4)
- JUND (4)
- JUP (4)
- KAT5 (4)
- LOX (4)
- MAP2K6 (4)
- MME (4)
- NTRK1 (4)
- PMS2 (4)
- PSMD3 (4)
- RAB25 (4)
- RAF1 (4)
- RHEB (4)
- RPS6KB1 (4)
- SCARB1 (4)
- SCN11A (4)
- SPAG4 (4)
- SRC (4)
- STAT5B (4)
- TRPC6 (4)
- XRCC6 (4)
- AATK (3)
- ABCF2 (3)
- ACO2 (3)
- ACTB (3)
- ACVR1C (3)
- ADM (3)
- ADRB3 (3)
- AGR3 (3)
- AGT (3)
- AHR (3)
- AIMP2 (3)
- AK1 (3)
- AKAP8 (3)
- AKAP8L (3)
- AKT2 (3)
- ALDH3B1 (3)
- ALDH4A1 (3)
- ALDOB (3)
- ALK (3)
- AMBRA1 (3)
- ANGPT1 (3)
- ANXA6 (3)
- AP1B1 (3)
- APLNR (3)
- APOH (3)
- APP (3)
- AQP3 (3)
- ARF6 (3)
- ARRB1 (3)
- ATF4 (3)
- BMP3 (3)
- BMX (3)
- BRCA1 (3)
- BSG (3)
- CAMK2B (3)
- CASP1 (3)
- CCND3 (3)
- CCR6 (3)
- CDK5 (3)
- CDKN1A (3)
- CDKN2A (3)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (3196)
- Transmembrane (1318)
- Transcription Factors (588)
- Secreted Protein (515)
- Protein Kinase (397)
- ES Cell Differentiation/IPS (270)
- Protease (205)
- Stem cell - Pluripotency (182)
- GPCR (138)
- Phosphatase (65)
- Adult stem cells (53)
- Embryonic stem cells (41)
- Ion Channels: Other (36)
- Nuclear Hormone Receptor (32)
- Cancer stem cells (31)
- Induced pluripotent stem cells (27)
- Stem cell relevant signaling - JAK/STAT signaling pathway (27)
- P450 (26)
- Ion Channels: Potassium (25)
- Ion Channels: Transient receptor potential (23)
- Stem cell relevant signaling - DSL/Notch pathway (21)
- Stem cell relevant signaling - Wnt Signaling pathway (19)
- Ion Channels: Glutamate Receptors (17)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (13)
- Ion Channels: Sodium (11)
- Ion Channels: Cys-loop Receptors (8)
- Ion Channels: Cyclic nucleotide gated (6)
- Ion Channels: Calcium (5)
- Ion Channels: ATP Receptors (1)
Pathways
- Metabolic pathways (396)
- Pathways in cancer (350)
- MAPK signaling pathway (261)
- Focal adhesion (188)
- Neurotrophin signaling pathway (163)
- Regulation of actin cytoskeleton (161)
- Chemokine signaling pathway (159)
- Neuroactive ligand-receptor interaction (143)
- Cytokine-cytokine receptor interaction (141)
- ErbB signaling pathway (136)
- Insulin signaling pathway (135)
- Prostate cancer (128)
- Cell cycle (127)
- Wnt signaling pathway (124)
- Alzheimer's disease (121)
- Endocytosis (119)
- Apoptosis (118)
- Chronic myeloid leukemia (118)
- Toll-like receptor signaling pathway (116)
- T cell receptor signaling pathway (112)
- Jak-STAT signaling pathway (110)
- Colorectal cancer (108)
- Huntington's disease (106)
- Leukocyte transendothelial migration (106)
- Progesterone-mediated oocyte maturation (105)
- Acute myeloid leukemia (101)
- Calcium signaling pathway (101)
- Pancreatic cancer (101)
- Small cell lung cancer (100)
- Axon guidance (98)
- Fc gamma R-mediated phagocytosis (96)
- Oocyte meiosis (95)
- GnRH signaling pathway (91)
- Renal cell carcinoma (89)
- Tight junction (88)
- Melanoma (86)
- Natural killer cell mediated cytotoxicity (86)
- B cell receptor signaling pathway (83)
- p53 signaling pathway (83)
- Glioma (82)
- Melanogenesis (81)
- Non-small cell lung cancer (80)
- Vascular smooth muscle contraction (79)
- Adipocytokine signaling pathway (78)
- Endometrial cancer (77)
- VEGF signaling pathway (77)
- mTOR signaling pathway (75)
- Ubiquitin mediated proteolysis (73)
- Fc epsilon RI signaling pathway (72)
- Long-term potentiation (70)
- Parkinson's disease (68)
- Adherens junction (66)
- Amyotrophic lateral sclerosis (ALS) (65)
- TGF-beta signaling pathway (65)
- Cell adhesion molecules (CAMs) (64)
- Gap junction (64)
- NOD-like receptor signaling pathway (57)
- Epithelial cell signaling in Helicobacter pylori infection (56)
- Bladder cancer (54)
- Purine metabolism (54)
- RIG-I-like receptor signaling pathway (52)
- Type II diabetes mellitus (52)
- Long-term depression (51)
- Dilated cardiomyopathy (49)
- PPAR signaling pathway (49)
- Pathogenic Escherichia coli infection (47)
- ECM-receptor interaction (45)
- Glycolysis / Gluconeogenesis (45)
- Lysosome (44)
- Hypertrophic cardiomyopathy (HCM) (39)
- Oxidative phosphorylation (39)
- Basal cell carcinoma (38)
- Complement and coagulation cascades (38)
- Hematopoietic cell lineage (38)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (37)
- Notch signaling pathway (36)
- Arginine and proline metabolism (34)
- Hedgehog signaling pathway (34)
- Phosphatidylinositol signaling system (33)
- Thyroid cancer (33)
- Viral myocarditis (33)
- Metabolism of xenobiotics by cytochrome P450 (32)
- Drug metabolism - cytochrome P450 (31)
- Alanine (29)
- Cytosolic DNA-sensing pathway (29)
- aspartate and glutamate metabolism (29)
- Vibrio cholerae infection (27)
- Cardiac muscle contraction (26)
- Systemic lupus erythematosus (26)
- Valine (26)
- Antigen processing and presentation (25)
- Fatty acid metabolism (25)
- Prion diseases (25)
- Tyrosine metabolism (25)
- ABC transporters (24)
- Butanoate metabolism (24)
- Glycerolipid metabolism (24)
- Type I diabetes mellitus (24)
- leucine and isoleucine degradation (24)
- Retinol metabolism (23)
- Fructose and mannose metabolism (22)
- Pyruvate metabolism (22)
- Taste transduction (22)
- Arachidonic acid metabolism (20)
- Histidine metabolism (20)
- Ribosome (20)
- Tryptophan metabolism (20)
- Androgen and estrogen metabolism (19)
- Cysteine and methionine metabolism (19)
- DNA replication (19)
- Inositol phosphate metabolism (19)
- Pyrimidine metabolism (19)
- SNARE interactions in vesicular transport (19)
- Spliceosome (19)
- Base excision repair (18)
- Proteasome (18)
- Regulation of autophagy (18)
- Citrate cycle (TCA cycle) (17)
- Renin-angiotensin system (16)
- Dorso-ventral axis formation (15)
- Galactose metabolism (15)
- Glutathione metabolism (15)
- Graft-versus-host disease (15)
- Homologous recombination (15)
- Pentose phosphate pathway (15)
- Starch and sucrose metabolism (15)
- Autoimmune thyroid disease (14)
- Biosynthesis of unsaturated fatty acids (14)
- beta-Alanine metabolism (14)
- Lysine degradation (13)
- Mismatch repair (13)
- Nucleotide excision repair (13)
- Olfactory transduction (13)
- Primary bile acid biosynthesis (13)
- Primary immunodeficiency (13)
- Sphingolipid metabolism (13)
- Maturity onset diabetes of the young (12)
- N-Glycan biosynthesis (12)
- Propanoate metabolism (12)
- RNA degradation (12)
- Allograft rejection (11)
- Amino sugar and nucleotide sugar metabolism (11)
- Basal transcription factors (11)
- Drug metabolism - other enzymes (11)
- Glycerophospholipid metabolism (11)
- Linoleic acid metabolism (11)
- Phenylalanine metabolism (11)
- C21-Steroid hormone metabolism (10)
- Nitrogen metabolism (10)
- Non-homologous end-joining (10)
- Ether lipid metabolism (9)
- Limonene and pinene degradation (9)
- Porphyrin and chlorophyll metabolism (9)
- Taurine and hypotaurine metabolism (9)
- Aminoacyl-tRNA biosynthesis (8)
- Riboflavin metabolism (8)
- Ascorbate and aldarate metabolism (7)
- Glycine (7)
- Pentose and glucuronate interconversions (7)
- Terpenoid backbone biosynthesis (7)
- serine and threonine metabolism (7)
- Folate biosynthesis (6)
- Glyoxylate and dicarboxylate metabolism (6)
- Nicotinate and nicotinamide metabolism (6)
- Other glycan degradation (6)
- alpha-Linolenic acid metabolism (6)
- Chondroitin sulfate biosynthesis (5)
- Glycosaminoglycan degradation (5)
- Pantothenate and CoA biosynthesis (5)
- Selenoamino acid metabolism (5)
- Steroid biosynthesis (5)
- Asthma (4)
- Fatty acid biosynthesis (4)
- Phenylalanine (4)
- leucine and isoleucine biosynthesis (4)
- tyrosine and tryptophan biosynthesis (4)
- Caffeine metabolism (3)
- D-Glutamine and D-glutamate metabolism (3)
- One carbon pool by folate (3)
- Sulfur metabolism (3)
- Synthesis and degradation of ketone bodies (3)
- Circadian rhythm - mammal (2)
- Fatty acid elongation in mitochondria (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (2)
- Heparan sulfate biosynthesis (2)
- Lysine biosynthesis (2)
- Protein export (2)
- Thiamine metabolism (2)
- Vitamin B6 metabolism (2)
- Cyanoamino acid metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Keratan sulfate biosynthesis (1)
- Methane metabolism (1)
- O-Glycan biosynthesis (1)
- O-Mannosyl glycan biosynthesis (1)
- RNA polymerase (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)