Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 85 results

Page 1 of 2

(reset)

Hexokinase 1 (HK1) Rabbit Polyclonal Antibody

TA326901

USD 380.00

3 Weeks

HK1 Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HK1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GFUS Rabbit Polyclonal Antibody

TA344243

USD 475.00

5 Days

Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hexokinase II (HK2) Rabbit Polyclonal Antibody

TA326886

USD 380.00

3 Weeks

Rabbit anti-HK2 Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HK2

1 / 2

2 / 2

Previous Next

GLCNE (GNE) Rabbit Polyclonal Antibody

TA315006

USD 345.00

In Stock

Rabbit polyclonal anti-GNE antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human GNE.

1 / 2

2 / 2

Previous Next

GALT Mouse Monoclonal Antibody [Clone ID: 4C11]

AM31056PU-N

USD 480.00

2 Weeks

GALT mouse monoclonal antibody, clone 4C11, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

Glucokinase (GCK) Rabbit Polyclonal Antibody

TA325004

USD 450.00

2 Weeks

Rabbit polyclonal GCK Antibody (N-term)

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK.

1 / 3

2 / 3

3 / 3

Previous Next

CYB5R3 Rabbit Polyclonal Antibody

AP20483PU-N

USD 370.00

2 Weeks

CYB5R3 rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

CYB5R3 (C-term) Goat Polyclonal Antibody

AP23662PU-N

USD 375.00

5 Days

CYB5R3 (C-term) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide from the C-terminus of human CYB5R3 (NP_000389.1; NP_001123291.1; NP_001165131.1).

1 / 2

2 / 2

Previous Next

HEXB Rabbit Polyclonal Antibody

TA314004

USD 345.00

4 Weeks

Rabbit polyclonal anti-HEXB antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB.

1 / 2

2 / 2

Previous Next

GLCNE (GNE) (N-term) Rabbit Polyclonal Antibody

AP51881PU-N

USD 450.00

2 Weeks

GLCNE (GNE) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 168-197 amino acids from the N-terminal region of Human GNE / GLCNE

1 / 2

2 / 2

Previous Next

PMM2 Rabbit Polyclonal Antibody

TA308120

USD 415.00

5 Days

Rabbit Polyclonal antibody to PMM2 (phosphomannomutase 2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 214 of PMM2 (Uniprot ID#O15305)

1 / 2

2 / 2

Previous Next

GMDS Rabbit Polyclonal Antibody

TA308887

USD 415.00

5 Days

Rabbit polyclonal antibody to GMDS (GDP-mannose 4,6-dehydratase)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 67 and 357 of GMDS (Uniprot ID#O60547)

1 / 2

2 / 2

Previous Next

CYB5R3 Rabbit Polyclonal Antibody

TA311774

USD 345.00

4 Weeks

Rabbit polyclonal anti-CYB5R3 antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human CYB5R3.
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

Hexokinase II (HK2) Rabbit Polyclonal Antibody

TA325029

USD 450.00

5 Days

Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II).

1 / 2

2 / 2

Previous Next

Hexokinase II (HK2) Rabbit Polyclonal Antibody

TA336240

USD 375.00

5 Days

Rabbit Polyclonal Anti-HK2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG

1 / 3

2 / 3

3 / 3

Previous Next

HEXA Rabbit Polyclonal Antibody

TA343107

USD 375.00

5 Days

Rabbit Polyclonal Anti-HEXA Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV

1 / 2

2 / 2

Previous Next

Glucokinase (GCK) Mouse Monoclonal Antibody [Clone ID: OTI3E3]

CF500459

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GCK mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5G9]

CF501127

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

CF501128

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI8G7]

CF501135

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI7G10]

CF501136

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

CF501137

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

CF501171

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CYB5R3 Mouse Monoclonal Antibody [Clone ID: OTI1E8]

CF501294

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CYB5R3 Mouse Monoclonal Antibody [Clone ID: OTI2A10]

CF501353

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Dog
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CYB5R3 Mouse Monoclonal Antibody [Clone ID: OTI1E3]

CF501385

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GALE Mouse Monoclonal Antibody [Clone ID: OTI1C4]

CF502146

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CYB5R1 Mouse Monoclonal Antibody [Clone ID: OTI4B7]

CF504564

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CYB5R1 mouse monoclonal antibody, clone OTI4B7 (formerly 4B7)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucokinase (GCK) Rabbit Polyclonal Antibody

TA321073

USD 345.00

In Stock

Anti-GCK Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4)

Glucokinase (GCK) Rabbit Polyclonal Antibody

TA321074

USD 345.00

In Stock

Anti-GCK Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hexokinase Type III (HK3) Rabbit Polyclonal Antibody

TA349616

USD 345.00

In Stock

Rabbit Polyclonal Anti-HK3 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human HK3

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Hexokinase II (HK2) Rabbit Polyclonal Antibody

TA349617

USD 345.00

In Stock

Rabbit Polyclonal Anti-HK2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human HK2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Hexokinase 1 (HK1) Rabbit Polyclonal Antibody

TA349618

USD 345.00

In Stock

Rabbit Polyclonal Anti-HK1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human HK1

GALK1 Rabbit Polyclonal Antibody

TA350005

USD 345.00

In Stock

Rabbit Polyclonal Anti-GALK1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human GALK1

GALT Rabbit Polyclonal Antibody

TA350006

USD 345.00

In Stock

Rabbit Polyclonal Anti-GALT Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GALT

Glucokinase (GCK) Rabbit Polyclonal Antibody

TA350011

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-GCK Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human GCK

UGP2 Rabbit Polyclonal Antibody

TA350571

USD 345.00

In Stock

Rabbit Polyclonal Anti-UGP2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Fusion protein of human UGP2

Glucokinase (GCK) Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA500459

USD 379.00

In Stock

GCK mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Glucokinase (GCK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E3]

TA500459AM

USD 420.00

5 Days

GCK mouse monoclonal antibody, clone 3E3, Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Glucokinase (GCK) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E3]

TA500459BM

USD 420.00

5 Days

GCK mouse monoclonal antibody, clone 3E3, HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Glucokinase (GCK) Mouse Monoclonal Antibody [Clone ID: OTI3E3]

TA500459S

USD 159.00

2 Days

GCK mouse monoclonal antibody, clone OTI3E3 (formerly 3E3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5G9]

TA501127

USD 379.00

In Stock

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G9]

TA501127AM

USD 420.00

4 Weeks

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G9]

TA501127BM

USD 420.00

4 Weeks

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5G9]

TA501127S

USD 159.00

2 Days

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA501128

USD 379.00

In Stock

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]

TA501128AM

USD 420.00

4 Weeks

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B11]

TA501128BM

USD 420.00

4 Weeks

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

TA501128S

USD 159.00

2 Days

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI8G7]

TA501135

USD 379.00

In Stock

Anti-GPI (Glucose 6 phosphate isomerase) mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 50 of 85 results

Page 1 of 2