Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caspase 3 (CPP32 4-1-18)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
Rabbit Polyclonal Anti-MMP9 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MMP9 |
Rabbit Polyclonal Anti-HGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HGF |
MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2 |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit Polyclonal Anti-MMP-9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP-9 Antibody: A synthesized peptide derived from human MMP-9 |
Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit anti-MMP2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MMP2 |
Rabbit Polyclonal MMP9 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MMP9 antibody was raised against a 16 amino acid peptide near the center of human MMP9. |
MMP9 mouse monoclonal antibody, clone SB15c, Purified
Applications | ELISA, IHC |
Reactivities | Human |
USD 440.00
2 Weeks
Prostate Specific Antigen (KLK3) (26-251) mouse monoclonal antibody, clone 5A11E2, Ascites
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9. |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP9 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Caspase 8 (CASP8) (C-term) rabbit polyclonal antibody, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CASP8 antibody was raised against synthetic peptide - KLH conjugated |
USD 250.00
2 Weeks
Prostate Specific Antigen (KLK3) mouse monoclonal antibody, clone A67-B/E3, Biotin
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit Polyclonal antibody to Caspase 8 (caspase 8, apoptosis-related cysteine peptidase)
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 217 of Caspase 8 (Uniprot ID#Q14790) |
Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Caspase 3. |
Anti-HGF Mouse Monoclonal (7-2) Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-CASP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase |
Rabbit polyclonal CASP3 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3. |
Rabbit polyclonal MMP1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Rabbit polyclonal CASP3(Asp175) Antibody
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP3(Asp175) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-179 amino acids from human CASP3(Asp175). |
Rabbit polyclonal Prostate-specific Antigen antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human prostate-specific Antigen. |
Rabbit anti-CASP9 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP9 |
Rabbit Polyclonal Anti-HGF Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP |
Rabbit Polyclonal active/cleaved Caspase 3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat, Canine, Gerbil |
Conjugation | Unconjugated |
Immunogen | Recombinant catalytically active human caspase-3 protein was used as immunogen. |
Mouse Monoclonal Caspase-8 Antibody (90A992)
Applications | FC, IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal Caspase-3 (Pro and Active) Antibody (31A1067)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 424.00
5 Days
Mouse Monoclonal Kallikrein 3/PSA Antibody (5A11E9)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal MMP-9 Antibody (4A3)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti MMP-2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to C-term of human MMP2. This sequence is identical among human, rat, mouse, chicken, dog and bovine. |
MMP9 mouse monoclonal antibody, clone SB15c, HRP
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | HRP |
Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast |
Immunogen | Recombinant human Caspase-3 protein (full length) |
Caspase 8 (CASP8) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic 15 amino acid peptide from near the carboxy terminus of human Caspase-8 (isoform E) |
MMP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | MMP1 antibody was raised against a synthetic peptide from near C-terminal of human MMP-1 protein. |
USD 475.00
2 Weeks
Prostate Specific Antigen (KLK3) mouse monoclonal antibody, clone CHYH2, HRP
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal anti-MMP-9 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MMP-9. |
Rabbit polyclonal Phospho-Caspase 9(S196) Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This Phospho-Caspase 9-S196 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S196 of human caspase 9. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-MMP2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
Rabbit Polyclonal Caspase-9 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat, Canine, Gerbil |
Conjugation | Unconjugated |
Immunogen | Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220). |
Rabbit Polyclonal Caspase-9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Canine, Gerbil |
Conjugation | Unconjugated |
Immunogen | Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220). |