Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 79 results

Page 1 of 2

(reset)

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: TB21]

AM39040PU-N

USD 570.00

2 Weeks

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified

Applications	Assay, ELISA, FC, IHC, NEUT, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

TGF beta 1 (TGFB1) Mouse Monoclonal Antibody [Clone ID: 8C4]

DM1050

USD 540.00

In Stock

TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free

Applications	ELISA, FN, IHC
Reactivities	Human
Conjugation	Unconjugated

IGF1 Rabbit Polyclonal Antibody

PP1020P2

USD 355.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

1 / 2

2 / 2

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA308889

USD 415.00

In Stock

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2)

1 / 3

2 / 3

3 / 3

Previous Next

IGF1 Rabbit Polyclonal Antibody

TA328347

USD 270.00

In Stock

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human IGF-I

TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody

TA313319

USD 345.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

1 / 2

2 / 2

Previous Next

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

TA325932

USD 345.00

4 Weeks

Rabbit Polyclonal TGFβ3 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

1 / 2

2 / 2

Previous Next

IGF1 Rabbit Polyclonal Antibody

TA332383

USD 275.00

3 Weeks

Rabbit anti-IGF1 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human IGF1

TNF alpha (TNF) (1-234) Mouse Monoclonal Antibody [Clone ID: M1-C4]

AM31768PU-N

USD 480.00

2 Weeks

TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Rat

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody

AP54230PU-N

USD 450.00

2 Weeks

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.

1 / 3

2 / 3

3 / 3

Previous Next

IGF1 Rabbit Polyclonal Antibody

PP1020P1

USD 260.00

2 Weeks

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications	ELISA, FN, IHC, WB
Reactivities	Human
Immunogen	Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

1 / 2

2 / 2

Previous Next

TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody

TA314617

USD 345.00

4 Weeks

Rabbit polyclonal anti-TGF beta2 antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human TGF β2.

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

TA314618

USD 345.00

In Stock

Rabbit polyclonal anti-TGF beta3 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human TGF β3.

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA317706

USD 425.00

In Stock

GNAS Rabbit Polyclonal (aa385-394) Antibody

Applications	IHC
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	GNAS antibody was raised against synthetic peptide from human GNAS.

TGF beta 3 (TGFB3) (C-term) Rabbit Polyclonal Antibody

AP23075PU-N

USD 440.00

2 Weeks

TGF beta 3 (TGFB3) (C-term) rabbit polyclonal antibody, Purified

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide derived from the C-terminus of the precursor form of human TGF beta 3

1 / 2

2 / 2

Previous Next

TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody

TA310081

USD 230.00

3 Weeks

Rabbit anti-TGFB1 polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	peptide coupled to KLH

1 / 2

2 / 2

Previous Next

IGF1 Goat Polyclonal Antibody

TA311185

USD 375.00

5 Days

Goat Anti-IGF1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1.

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Goat Polyclonal Antibody

TA328454

USD 285.00

5 Days

Anti-Human TNF-a Goat Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

G protein alpha S (GNAS) (164-394) Rabbit Polyclonal Antibody

AP23581PU-N

USD 440.00

2 Weeks

G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS

1 / 3

2 / 3

3 / 3

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA308888

USD 415.00

5 Days

Rabbit Polyclonal antibody to GNAS (GNAS complex locus)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2)

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications	IHC, WB
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA328455

USD 285.00

5 Days

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA329505

USD 310.00

5 Days

Rabbit Polyclonal anti-GNAS antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

CF506510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]

CF805748

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI3A6]

CF805792

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IGF1 mouse monoclonal antibody, clone OTI3A6 (formerly 3A6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

CF807833

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7H4]

CF809260

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7H4

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A6]

CF809270

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A6

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]

CF809271

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI7A4]

CF809314

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A4

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13G5]

CF809325

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13G5

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody

TA323601

USD 345.00

4 Weeks

Anti-TGFB1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 30-278 amino acids of human transforming growth factor, beta 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA323636

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus

G protein alpha S (GNAS) Rabbit Polyclonal Antibody

TA323637

USD 345.00

In Stock

Anti-GNAS Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus

1 / 3

2 / 3

3 / 3

Previous Next

IGF1 Rabbit Polyclonal Antibody

TA350696

USD 345.00

In Stock

Rabbit Polyclonal Anti-IGF1 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human IGF1

1 / 2

2 / 2

Previous Next

TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody

TA351797

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-TGFB2 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human TGFB2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody

TA357538

USD 360.00

5 Days

TGFB3 Antibody - middle region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human TGFB3

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA506510

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D9]

TA506510AM

USD 420.00

4 Weeks

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), Biotinylated

Applications	IHC, WB
Reactivities	Human
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D9]

TA506510BM

USD 420.00

4 Weeks

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9), HRP conjugated

Applications	IHC, WB
Reactivities	Human
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]

TA506510S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IGF1 Mouse Monoclonal Antibody [Clone ID: OTI4B12]

TA805748

USD 379.00

In Stock

IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IGF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B12]

TA805748AM

USD 420.00

4 Weeks

IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IGF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B12]

TA805748BM

USD 420.00

4 Weeks

IGF1 mouse monoclonal antibody, clone OTI4B12 (formerly 4B12), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 50 of 79 results

Page 1 of 2