Germany
Japan
United Kingdom
China
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Antibodies
View as table Download
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Goat Polyclonal Antibody against CD32 / FCGR2B
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;. |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Mouse Monoclonal CD45R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PTPRC Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CD45 antibody was raised against synthetic 16 amino acid peptide from internal region of human CD45. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (88%). |
Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13D7 (formerly 13D7)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Mouse Monoclonal PTPRC (CD45) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal CD45RO Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Applications
- IHC
Families
- Transmembrane
Pathways
- Fc gamma R-mediated phagocytosis