Antibodies

View as table Download

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.

Adenosine Receptor A2a (ADORA2A) (full length) mouse monoclonal antibody, clone 7F6-G5-A2 / 7F6, Purified

Applications FC, IHC, WB
Reactivities Canine, Guinea Pig, Human, Mouse, Rabbit, Rat

Mouse Monoclonal anti-CACNA1C Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ADORA2B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B.

Anti-RAMP1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 27-117 amino acids of human receptor (G protein-coupled) activity modifying protein 1

Rabbit Polyclonal AGTR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AGTR1 antibody was raised against a 16 amino acid peptide from near the center of human AGTR1.

Adenylate cyclase 1 (ADCY1) (aa 230-280) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 230-280 of Human ADCY 1.

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Rabbit polyclonal antibody to Adenosine A2A-R (adenosine A2a receptor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 338 and 412 of Adenosine A2a Receptor (Uniprot ID#P29274)

Rabbit Polyclonal antibody to RAMP2 (receptor (G protein-coupled) activity modifying protein 2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 111 and 175 of RAMP2 (Uniprot ID#O60895)

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)

Rabbit Polyclonal Anti-A2B Adenosine Receptor (extracellular)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide KDSATNN*STEPWDGTTNESC, corresponding to amino acid residues 147-166 of human A2B Adenosine Receptor with replacement of cysteine 154 (C154) with serine (*S). 2nd extracellular loop.

ADCY5 (+ADCY6) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 1111-1160 of Human ADCY 5.

KCNMA1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 750-800 of Human MaxiKα

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D

Mouse Monoclonal anti-slo1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.

CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%).

CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Orang-Utan
Conjugation Unconjugated
Immunogen CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%).

Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus.

Angiotensin II Type 1 Receptor (AGTR1) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated, Synthetic peptide

alpha 1b Adrenergic Receptor (ADRA1B) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 276~306 amino acids from the Central region of human ADRA1B

Goat Anti-Adenosine A2b Receptor Antibody

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQADVKSGNGQ, from the C Terminus of the protein sequence according to NP_000667.1.

Rabbit polyclonal antibody to CACNA1S (calcium channel, voltage-dependent, L type, alpha 1S subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 544 and 885 of CACNA1S (Uniprot ID#Q13698)

Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928)

Rabbit polyclonal anti-ADORA2A antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADORA2A.
Modifications Phospho-specific

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.

Rabbit Polyclonal Anti-KCNMA1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG

ITPR2 (1152-1164) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from an internal region of human ITPR2

alpha 1a Adrenergic Receptor (ADRA1A) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen Synthetic peptide corresponding to a region within amino acids 206 and 270 of Human Alpha-1A adrenergic receptor

Rabbit polyclonal anti-ADRA1D antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADRA1D.

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat
Conjugation Unconjugated
Immunogen ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%).

Rabbit Polyclonal Anti-slobeta2 (KCNMB2)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)RHDEKRNIYQKIRDHDLLD, corresponding to amino acid residues 14-32 of human sloÃ?2.Intracellular, N-terminal part.

Rabbit Polyclonal Anti-alpha1A-Adrenoceptor (extracellular)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide EDETI*SQINEEPG(C), corresponding to amino acid residues 171-183 of human a1A adrenoceptor with replacement of cysteine 176 (C176) with serine. 2nd extracellular loop.

Rabbit Polyclonal Anti-ADORA2B Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADORA2B/Adenosine A2B Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Adenosine A2b Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Horse (94%); Rabbit (88%); Dog (81%).

Mouse monoclonal Anti-Cytochrome P450 4A11 Clone M25-P2A10

Applications IHC, WB
Reactivities Drosophila, Human, Mouse, Rat, Xenopus
Conjugation Unconjugated

KCNMB1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse
Conjugation Unconjugated
Immunogen KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%).

AVPR1B Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit, Rat
Conjugation Unconjugated
Immunogen AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%).

Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog
Conjugation Unconjugated
Immunogen ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Dog (100%); Elephant (90%); Bat (85%); Opossum, Platypus (80%).

Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Mouse, Hamster, Elephant (85%).

KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla
Immunogen KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%).

KCNMB3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human
Immunogen KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%).

Mouse Monoclonal Anti-BKBeta4 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ADORA2A Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ADORA2A/Adenosine A2A Receptor antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human ADORA2A. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (95%); Dog (80%).

Rabbit Polyclonal Anti-ADRA1D Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen ADRA1D antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human ADRA1D. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Dog, Panda, Horse, Pig, Guinea pig (100%); Mouse, Rat, Bovine, Hamster, Rabbit, Opossum (94%); Bat (89%).

Rabbit Polyclonal Anti-AVPR1A Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen AVPR1A / V1a Receptor antibody was raised against synthetic 18 amino acid peptide from cytoplasmic domain of human AVPR1A. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Marmoset, Horse, Rabbit (89%); Mouse (83%).

Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%).

Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%).