Germany
Japan
United Kingdom
China
USD 815.00
2 Weeks
SNAP25 (Toxin A cleaved form) mouse monoclonal antibody, clone B371M, Supernatant
| Applications | ELISA, IHC |
Antibodies
View as table Download
Rabbit Polyclonal Anti-CAT Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
Rabbit Polyclonal Anti-MDS032 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE |
SNAP25 (Total) mouse monoclonal antibody, clone B372M, Supernatant
| Applications | ELISA, IHC |
USD 480.00
2 Weeks
SNAP23 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_003816.2 and NP_570710.1. |
Syntaxin 2 (STX2) (1-19) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Bovine, Chicken, Drosophila, Hamster, Human, Insect, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | STX2 antibody was raised against rat syntaxin 2 synthetic peptide, corresponding to amino acid residues 1-19, conjugated to KLH. |
USD 440.00
2 Weeks
Syntaxin 12 (STX12) (Cytopl. Dom.) mouse monoclonal antibody, clone 15G2, Purified
| Applications | IHC, WB |
| Reactivities | Canine, Hamster, Human, Mouse, Rat |
Rabbit Polyclonal Anti-USE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS |
Rabbit Polyclonal Anti-STX1A Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | STX1A / Syntaxin 1A antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Pig, Xenopus (100%); Panda, Dog, Bat, Bovine, Horse, Opossum, Turkey, Chicken (93%); Elephant (87%); Drosophila, Mosquito, Water flea, Nematode, Beetle (80%). |
Rabbit Polyclonal Anti-STX1A Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | STX1A / Syntaxin 1A antibody was raised against synthetic 16 amino acid peptide from internal region of human STX1A / Syntaxin 1A. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Pig, Opossum, Turkey, Chicken (100%); Horse, Xenopus (94%); Gibbon, Sheep, Zebra finch, Salmon, Stickleback, Pufferfish, Zebrafish, Ant, Water flea (88%); Beetle (81%). |
Anti-BNIP1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 4-227 amino acids of human BCL2/adenovirus E1B 19kDa interacting protein 1 |
Anti-STX1A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of human syntaxin 1A (brain) |
Anti-SNAP25 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SNAP23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SNAP23 |
Rabbit Polyclonal Anti-STX7 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX7 |
Rabbit Polyclonal Anti-STX16 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX16 |
Rabbit Polyclonal Anti-STX18 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX18 |
Rabbit Polyclonal Anti-STX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STX10 |
Rabbit Polyclonal Anti-VAMP4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-VAMP5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Category
- Antibodies
Applications
- IHC
Pathways
- SNARE interactions in vesicular transport