Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
USD 524.00
In Stock
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Anti-SOX2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human SRY (sex determining region Y)-box 2 |
Anti-LAMA1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1606-1620 amino acids of Human laminin, alpha 1 |
Anti-ABCG2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 609-621 amino acids of Human ATP-binding cassette sub-family G member 2 |
Anti-CEBPA Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 82-100 amino acids of Human CCAAT/enhancer binding protein (C/EBP), alpha |
Anti-TUBB3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 57-294 amino acids of Human Tubulin beta-3 chain |
Rabbit Polyclonal Anti-ITGA6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ITGA6 |
Rabbit Polyclonal Anti-CYP7A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP7A1 |
Rabbit Polyclonal Anti-WNT2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human WNT2 |
Active filters
Applications
- IHC
Isotypes
- IgG
Families
- ES Cell Differentiation/IPS
Citations
- Yes
Filter by
Category
Target Symbol
- GAPDH (2)
- ABCG2 (1)
- AKT1 (1)
- ANPEP (1)
- BST2 (1)
- CASP3 (1)
- CD81 (1)
- CDH5 (1)
- CEBPA (1)
- CTNNB1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- DLL4 (1)
- EGFR (1)
- G6PC (1)
- GATA3 (1)
- GLI1 (1)
- ITGA2B (1)
- ITGA6 (1)
- JMJD6 (1)
- KDR (1)
- LAMA1 (1)
- LAMP1 (1)
- LIF (1)
- MKI67 (1)
- NOTCH1 (1)
- PDGFRA (1)
- PECAM1 (1)
- PRNP (1)
- PROM1 (1)
- SLC2A1 (1)
- SOX2 (1)
- TNFRSF8 (1)
- TUBB3 (1)
- WNT2 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (12)
- Focal adhesion (8)
- Metabolic pathways (6)
- Colorectal cancer (5)
- Cytokine-cytokine receptor interaction (5)
- MAPK signaling pathway (4)
- Prostate cancer (4)
- Regulation of actin cytoskeleton (4)
- Small cell lung cancer (4)
- Adipocytokine signaling pathway (3)
- Alzheimer's disease (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Basal cell carcinoma (3)
- Cell adhesion molecules (CAMs) (3)
- ECM-receptor interaction (3)
- Endocytosis (3)
- Endometrial cancer (3)
- Gap junction (3)
- Glioma (3)
- Glycolysis / Gluconeogenesis (3)
- Hematopoietic cell lineage (3)
- Leukocyte transendothelial migration (3)
- Melanoma (3)
- Acute myeloid leukemia (2)
- Adherens junction (2)
- Apoptosis (2)
- B cell receptor signaling pathway (2)
- Calcium signaling pathway (2)
- Dilated cardiomyopathy (2)
- Dorso-ventral axis formation (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Hedgehog signaling pathway (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Insulin signaling pathway (2)
- Jak-STAT signaling pathway (2)
- Melanogenesis (2)
- Non-small cell lung cancer (2)
- Notch signaling pathway (2)
- Pancreatic cancer (2)
- Pathogenic Escherichia coli infection (2)
- Prion diseases (2)
- Renal cell carcinoma (2)
- Tight junction (2)
- VEGF signaling pathway (2)
- Wnt signaling pathway (2)
- ABC transporters (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Bladder cancer (1)
- Chemokine signaling pathway (1)
- Chronic myeloid leukemia (1)
- Drug metabolism - cytochrome P450 (1)
- Drug metabolism - other enzymes (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Galactose metabolism (1)
- Glutathione metabolism (1)
- GnRH signaling pathway (1)
- Huntington's disease (1)
- Linoleic acid metabolism (1)
- Lysosome (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- Natural killer cell mediated cytotoxicity (1)
- Neurotrophin signaling pathway (1)
- PPAR signaling pathway (1)
- Parkinson's disease (1)
- Primary bile acid biosynthesis (1)
- Progesterone-mediated oocyte maturation (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- Starch and sucrose metabolism (1)
- T cell receptor signaling pathway (1)
- Thyroid cancer (1)
- Toll-like receptor signaling pathway (1)
- Viral myocarditis (1)
- mTOR signaling pathway (1)
- p53 signaling pathway (1)