Antibodies

View as table Download

Rabbit anti-GSTP1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTP1

Rabbit Polyclonal Anti-GPX4 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA

Rabbit Polyclonal Anti-GSTM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM2 antibody: synthetic peptide directed towards the N terminal of human GSTM2. Synthetic peptide located within the following region: TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF

RRM1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RRM1

GSTT1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GSTT1

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Rabbit Polyclonal Anti-GSTT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTT1 antibody: synthetic peptide directed towards the C terminal of human GSTT1. Synthetic peptide located within the following region: TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit Polyclonal GSTP1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.

Rabbit Polyclonal antibody to IDH2 (isocitrate dehydrogenase 2 (NADP+), mitochondrial)

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 56 and 345 of IDH2 (Uniprot ID#P48735)

Rabbit anti-ANPEP Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANPEP

Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210)

Rabbit polyclonal antibody to Glutathione Peroxidase 2 (glutathione peroxidase 2 (gastrointestinal))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 54 of GPX2

GGT1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GGT1

Goat Polyclonal Antibody against GPX4

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EEPLVIEKDLPHY, from the C Terminus of the protein sequence according to NP_002076.2; NP_001034937.1.

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

Rabbit polyclonal GCLM Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping at the C-terminus of GSTpi of human origin

Isocitrate dehydrogenase (IDH1) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen IDH1 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211)

Rabbit polyclonal anti-MGST3 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MGST3.

Rabbit polyclonal GSTO1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GSTO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 126-155 amino acids from the Central region of human GSTO1.

Rabbit polyclonal GSTM1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GSTM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 184-211 amino acids from the C-terminal region of human GSTM1.

RRM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RRM2

Goat Polyclonal Antibody against GPX1

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2.

Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217)

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

Rabbit Polyclonal antibody to GSTO1 (glutathione S-transferase omega 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 30 and 241 of GSTO1 (Uniprot ID#P78417)

Rabbit polyclonal antibody to GSTT1 (glutathione S-transferase theta 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 240 of GSTT1 (Uniprot ID#P30711)

Rabbit Polyclonal Anti-GCLM Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

Anti-ODC1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human ornithine decarboxylase 1

Anti-RRM1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1

Anti-GSR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

Anti-GSR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

Rabbit Polyclonal Anti-IDH1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH1

Rabbit Polyclonal Anti-GSTA2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GSTA2

Rabbit Polyclonal Anti-GGT1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GGT1

Rabbit Polyclonal Anti-GSTO1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GSTO1

Rabbit Polyclonal Anti-GSTA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GSTA3

Rabbit Polyclonal Anti-GSTP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GSTP1

Rabbit Polyclonal Anti-IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH2

Rabbit Polyclonal Anti-ANPEP Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANPEP