Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal Cyclin B1 (Ab-126) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S). |
Rabbit polyclonal Cyclin B1 (Ser147) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 147 (A-F-SP-D-V). |
| Modifications | Phospho-specific |
CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human APC1. |
Anti-CCNB1 (phospho-Ser147) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of Serine 147 (A-F-S(p)-D-V) derived from Human Cyclin B1. |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit Polyclonal Anti-CDK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit polyclonal APC1 phospho S377 antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 373-382 of Human Apc1 protein. |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-HSP90AB1 Antibody
| Applications | IHC |
| Reactivities | Humann, Rabbit, Rat, Mouse, Chicken |
| Conjugation | Unconjugated |
Rabbit polyclonal APC1(Ser355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human APC1 around the phosphorylation site of serine 355 (A-H-SP-P-A). |
| Modifications | Phospho-specific |
Mouse monoclonal Hsp90 Antibody
| Applications | IHC |
| Reactivities | Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line |
| Conjugation | Unconjugated |
Anti-CDK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |
Anti-CCNB2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human cyclin B2 |
Rabbit Polyclonal Anti-ANAPC1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ANAPC1 |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Stem cell - Pluripotency
Pathways
- Progesterone-mediated oocyte maturation