Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 64 results

Page 1 of 2

(reset)

DNMT1 Rabbit Monoclonal Antibody [Clone ID: EPR3521(2)]

TA307586

USD 516.00

In Stock

Rabbit monoclonal antibody against Dnmt1(clone EPR3521(2))

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

DNMT3A Mouse Monoclonal Antibody [Clone ID: 64B1446]

TA336580

USD 512.00

5 Days

Mouse Monoclonal DNMT3A Antibody (64B1446)

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody

TA346572

USD 475.00

5 Days

Rabbit Polyclonal Anti-LDHB Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CBS Rabbit Polyclonal Antibody

TA308071

USD 415.00

In Stock

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications	IF, IHC, IP, WB
Reactivities	Human
Immunogen	Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LDHA Rabbit Monoclonal Antibody [Clone ID: EP1563Y]

TA300879

USD 509.00

In Stock

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

MTAP Rabbit Polyclonal Antibody

TA326900

USD 275.00

3 Weeks

MTAP Rabbit Polyclonal Antibody

Applications	ICC/IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human MTAP

1 / 2

2 / 2

Previous Next

MTR Goat Polyclonal Antibody

TA302710

USD 375.00

In Stock

Goat Polyclonal Antibody against MTR

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

1 / 2

2 / 2

Previous Next

CBS Rabbit Polyclonal Antibody

TA338394

USD 310.00

5 Days

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

MAT1A Rabbit Polyclonal Antibody

TA346036

USD 410.00

5 Days

Rabbit Polyclonal Anti-MAT1A Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

1 / 2

2 / 2

Previous Next

DNMT3B Rabbit Polyclonal Antibody

TA313761

USD 345.00

4 Weeks

Rabbit polyclonal anti-DNMT3B antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

DNMT3B (1-50) Rabbit Polyclonal Antibody

AP31351PU-N

USD 440.00

2 Weeks

DNMT3B (1-50) rabbit polyclonal antibody, Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide from Human DNMT3B (aa 1-50)

1 / 3

2 / 3

3 / 3

Previous Next

DNMT1 Mouse Monoclonal Antibody [Clone ID: 60B1220.1]

TA326439

USD 410.00

5 Days

Mouse monoclonal DNMT1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Zebrafish
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

DNMT1 Mouse Monoclonal Antibody [Clone ID: 60B1220.1]

TA336382

USD 479.00

5 Days

Mouse Monoclonal DNMT1 Antibody (60B1220.1)

Applications	IHC, WB
Reactivities	Human, Mouse, Zebrafish
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Lactate Dehydrogenase B (LDHB) Mouse Monoclonal Antibody [Clone ID: 2H6]

AM20910PU-N

USD 480.00

2 Weeks

Lactate Dehydrogenase B (LDHB) mouse monoclonal antibody, clone 2H6

Applications	ELISA, IF, IHC, WB
Reactivities	Human

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 3E1]

AM31730PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications	ELISA, IHC, IP, WB
Reactivities	Human, Rat

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

TAT (Center) Rabbit Polyclonal Antibody

AP54159PU-N

USD 450.00

2 Weeks

TAT (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 285~315 amino acids from the Central region of human TAT

1 / 3

2 / 3

3 / 3

Previous Next

AMD1 Rabbit Polyclonal Antibody

TA323135

USD 345.00

In Stock

Anti-AMD1 rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

1 / 2

2 / 2

Previous Next

DNMT1 Rabbit Polyclonal Antibody

TA323183

USD 345.00

In Stock

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

LDHA Rabbit Polyclonal Antibody

TA326950

USD 345.00

3 Weeks

Rabbit anti-LDHA Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human LDHA

1 / 3

2 / 3

3 / 3

Previous Next

DNMT1 Rabbit Polyclonal Antibody

TA336293

USD 490.00

5 Days

Rabbit Polyclonal DNMT1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Contained within amino acids 1-125 of the N-terminus of human Dnmt1 [UniProt# P26358]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6B8]

AM31731PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 6A9]

AM31732PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

CBSL Mouse Monoclonal Antibody [Clone ID: 5F7]

AM31733PU-N

USD 480.00

2 Weeks

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 3

2 / 3

3 / 3

Previous Next

AMD1 (C-term) Rabbit Polyclonal Antibody

AP23364PU-N

USD 405.00

2 Weeks

AMD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to a sequence at the C-terminal of human SAMDC

1 / 2

2 / 2

Previous Next

S adenosylhomocysteine hydrolase (AHCY) (N-term) Rabbit Polyclonal Antibody

AP50117PU-N

USD 450.00

2 Weeks

S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified

Applications	FC, IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY

1 / 3

2 / 3

3 / 3

Previous Next

LDHA (Center) Rabbit Polyclonal Antibody

AP52459PU-N

USD 450.00

2 Weeks

LDHA (Center) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 161~190 amino acids from the Central region of Human LDHA

1 / 3

2 / 3

3 / 3

Previous Next

DNMT3A Rabbit Polyclonal Antibody

TA301633

USD 424.00

5 Days

Rabbit Polyclonal Antibody against DNMT3a

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This antibody was raised against amino acids 10-118 of the human DNMT3a protein.

1 / 3

2 / 3

3 / 3

Previous Next

AHCYL2 Rabbit Polyclonal Antibody

TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

1 / 3

2 / 3

3 / 3

Previous Next

LDHA Rabbit Polyclonal Antibody

TA336781

USD 424.00

5 Days

Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338]

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

MAT1A (N-term) Rabbit Polyclonal Antibody

AP52613PU-N

USD 450.00

2 Weeks

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

1 / 2

2 / 2

Previous Next

MTAP Rabbit Polyclonal Antibody

TA308228

USD 415.00

5 Days

Rabbit Polyclonal antibody to MTAP (methylthioadenosine phosphorylase)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 283 of MTAP (Uniprot ID#Q13126)

1 / 2

2 / 2

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: n.a]

AM20537PU-N

USD 440.00

2 Weeks

LDHA mouse monoclonal antibody, clone n.a, Purified

Applications	IHC
Reactivities	Human

1 / 2

2 / 2

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2C11]

CF500518

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2B11]

CF500531

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI5G10]

CF500558

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2D11]

CF500568

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

DNMT3L Rabbit Polyclonal Antibody

TA321824

USD 345.00

In Stock

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

DNMT3L Rabbit Polyclonal Antibody

TA321825

USD 345.00

4 Weeks

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

1 / 2

2 / 2

Previous Next

DNMT3A Rabbit Polyclonal Antibody

TA322195

USD 345.00

4 Weeks

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

DNMT3A Rabbit Polyclonal Antibody

TA322196

USD 345.00

In Stock

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

AMD1 Rabbit Polyclonal Antibody

TA323134

USD 345.00

In Stock

Anti-AMD1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

DNMT1 Rabbit Polyclonal Antibody

TA323184

USD 345.00

In Stock

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

1 / 2

2 / 2

Previous Next

AMD1 Rabbit Polyclonal Antibody

TA323399

USD 345.00

In Stock

Anti-AMD1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

AMD1 Rabbit Polyclonal Antibody

TA323400

USD 345.00

In Stock

Anti-AMD1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

TAT Rabbit Polyclonal Antibody

TA323688

USD 345.00

In Stock

Anti-TAT Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

DNMT3A Rabbit Polyclonal Antibody

TA349525

USD 345.00

In Stock

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human DNMT3A

CBS Rabbit Polyclonal Antibody

TA349577

USD 345.00

In Stock

Rabbit Polyclonal Anti-CBS Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human CBS

1 / 3

2 / 3

3 / 3

Previous Next

Dnmt2 (TRDMT1) Rabbit Polyclonal Antibody

TA350651

USD 345.00

In Stock

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human TRDMT1

1 / 2

2 / 2

Previous Next

LDHA Mouse Monoclonal Antibody [Clone ID: OTI2C11]

TA500518

USD 379.00

In Stock

LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

LDHA Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C11]

TA500518AM

USD 420.00

5 Days

LDHA mouse monoclonal antibody, clone 2C11, Biotinylated

Applications	IHC, IP, WB
Reactivities	Human, Mouse
Conjugation	Biotin

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 50 of 64 results

Page 1 of 2