Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the rat Calnexin protein (between residues 550-591) [UniProt P35565] |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
Optineurin Rabbit Polyclonal (aa575-591) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OPTN / Optineurin antibody was raised against synthetic peptide corresponding to aa 559-575 (GEVLPDIDTLQIHVMDC) of human, mouse and rat optineurin |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal HP1-gamma Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Hamster, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against HMGB1 - Oligodendrocyte Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Dog, Bovine, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human HMGB1 protein sequence (between residues 100-200). [UniProt #P09429] |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Anti-Hepsin Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Orang-Utan, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | HPN / TMPRSS1 / Hepsin antibody was raised against human hepsin amino acids 241-260 (GGYLPFRDPNSEENSNDIAL). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bovine, Dog, Bat, Panda, Rabbit (100%); Opossum (95%); Hamster, Horse (90%); Mouse, Rat (85%); Xenopus (80%). |
Anti-IGFBP-5 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Goat, Hamster, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | IGFBP5 antibody was raised against human IGFBP5 amino acids 192-206 (CRRHMEASLQELKAS). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Bat, Bovine, Goat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Mouse, Rat, Opossum, Chicken (93%); Marmoset (87%). |
INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%). |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
SLC22A17 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC22A17 antibody was raised against synthetic peptide C-PETKRKLLPEVLRD from an internal region of human SLC22A17 (NP_065105.2; NP_057693.3). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bat, Bovine, Horse, Pig (100%); Elephant, Rabbit (93%). |
UCP2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
Anti-ROR1 Goat Polyclonal () Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ROR1 antibody was raised against synthetic peptide C-GNKSQKPYKIDSKQA from the C-terminus (near) of human ROR1 (NP_005003.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Lizard (93%); Turkey, Chicken (87%); Platypus (80%). |
DOK3 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DOK3 antibody was raised against synthetic peptide TRERRKGPAPCDRP from the C-terminus of human DOK3 (NP_079148.2). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Rabbit (93%); Bovine, Bat (86%). |
Rabbit polyclonal PCNA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA. |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 300-360). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
GLG1 / MG160 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | GLG1 / MG160 antibody was raised against synthetic 18 amino acid peptide from internal region of human GLG1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum, Turkey, Chicken, Xenopus, Zebrafish (100%); Stickleback (89%). |
GPC4 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Hamster, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | GPC4 / Glypican 4 antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human GPC4 / Glypican 4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Pig (100%); Marmoset, Mouse, Elephant, Bovine, Horse (94%); Rat, Bat, Rabbit (88%). |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal PRDX2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PRDX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 169-198 amino acids from the C-terminal region of human PRDX2. |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%). |
Rabbit Polyclonal Anti-LGR5 Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR49 / LGR5 antibody was raised against synthetic 20 amino acid peptide from 1st cytoplasmic domain of human GPR49 / LGR5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Bovine, Bat (95%); Hamster, Elephant, Panda, Rabbit (90%); Mouse, Rat, Opossum (85%). |
Mouse Monoclonal hHR23b Antibody
| Applications | IF, IHC, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against FAU (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FAU antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-59 amino acids from the C-terminal region of human FAU. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Quail, Rabbit, Sheep, Drosophila, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Dog calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
GRPR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Dog, Bat, Pig (100%); Panda, Rabbit, Opossum (94%); Horse (88%); Turkey, Chicken, Lizard (82%). |
FKSG80 / GPR81 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Dog, Gorilla, Hamster, Human, Monkey, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | FKSG80 / GPR81 antibody was raised against synthetic 16 amino acid peptide from 2nd extracellular domain of human GPR81. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Rat, Dog, Bat, Hamster, Panda, Rabbit, Opossum (100%); Mouse, Horse, Pig, Platypus (94%); Bovine (88%); Elephant (81%). |
HTR6 / 5-HT6 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | HTR6 / 5-HT6 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human HTR6 / 5-HT36. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Horse (100%); Mouse, Elephant, Bovine, Bat, Rabbit (94%); Stickleback, Pufferfish (88%); Turkey, Chicken, Xenopus, Zebrafish (82%). |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%). |
WNT7A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%). |
GPR137B Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPR137B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPR137B / TM7SF1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Horse, Rabbit, Pig, Opossum (100%); Hamster, Elephant, Bovine (94%); Goat, Chicken, Lizard (88%); Dog, Bat, Turkey (81%). |
CNR2 / CB2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | CNR2 / CB2 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human CNR2 / CB2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog (100%); Mouse, Rat, Elephant, Panda (95%); Hamster, Bat, Horse (90%); Rabbit (85%). |
Active filters
Reactivities
- Hamster
Applications
- IHC
Families
- Druggable Genome
Filter by
Category
Target Symbol
- HSPD1 (5)
- GLG1 (3)
- ADRA1B (2)
- CANX (2)
- CXCR5 (2)
- DRD3 (2)
- ERP44 (2)
- GPC4 (2)
- HP1 GAMMA (2)
- KCNJ6 (2)
- KCNMA1 (2)
- NR2E3 (2)
- WNT4 (2)
- ABCG1 (1)
- ACKR4 (1)
- ADAMTS5 (1)
- ADGRA2 (1)
- ADGRF5 (1)
- AGTR2 (1)
- CADM2 (1)
- CALCRL (1)
- CELSR3 (1)
- CHRM3 (1)
- CNR2 (1)
- DDR1 (1)
- DOK3 (1)
- DPP10 (1)
- DPP9 (1)
- EPHB2 (1)
- ESRRB (1)
- FASN (1)
- FAU (1)
- FKBP4 (1)
- GHRHR (1)
- GPR137B (1)
- GPR139 (1)
- GPR173 (1)
- GPR183 (1)
- GPR19 (1)
- GPR3 (1)
- GPR55 (1)
- GPR61 (1)
- GPR88 (1)
- GPRC6A (1)
- GRM1 (1)
- GRM2 (1)
- GRM4 (1)
- GRPR (1)
- HCAR1 (1)
- HMGB1 (1)
- HPN (1)
- HRH1 (1)
- HRH3 (1)
- HSP90B1 (1)
- HTR1F (1)
- HTR4 (1)
- HTR6 (1)
- IGFBP5 (1)
- ITGA3 (1)
- KCNH2 (1)
- KCNQ1 (1)
- KCNQ2 (1)
- KDR (1)
- LGR5 (1)
- LPAR4 (1)
- MAP2K1 (1)
- MAP3K8 (1)
- MC3R (1)
- MELTF (1)
- MMP13 (1)
- NMBR (1)
- NPC1 (1)
- NPSR1 (1)
- NR5A1 (1)
- OPTN (1)
- PCNA (1)
- PDE1C (1)
- PDE6A (1)
- PIB5PA (1)
- PRDX2 (1)
- PTGES (1)
- PTPRM (1)
- RAD23B (1)
- ROR1 (1)
- S1PR1 (1)
- SCARB1 (1)
- SLC22A17 (1)
- SLC7A2 (1)
- SLITRK6 (1)
- SOD2 (1)
- SSTR1 (1)
- TAOK1 (1)
- TAS1R1 (1)
- TLL2 (1)
- TNIK (1)
- TP53 (1)
- TRPV2 (1)
- TRPV4 (1)
- TSPAN13 (1)
- TUBB (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (23)
- Calcium signaling pathway (9)
- Pathways in cancer (8)
- Vascular smooth muscle contraction (6)
- Basal cell carcinoma (5)
- Melanogenesis (5)
- RNA degradation (5)
- Type I diabetes mellitus (5)
- Wnt signaling pathway (5)
- Cell adhesion molecules (CAMs) (4)
- Hedgehog signaling pathway (4)
- MAPK signaling pathway (4)
- Chemokine signaling pathway (3)
- Cytokine-cytokine receptor interaction (3)
- Focal adhesion (3)
- Gap junction (3)
- Metabolic pathways (3)
- Prostate cancer (3)
- Regulation of actin cytoskeleton (3)
- Antigen processing and presentation (2)
- Base excision repair (2)
- Bladder cancer (2)
- Cell cycle (2)
- Chronic myeloid leukemia (2)
- Colorectal cancer (2)
- Endometrial cancer (2)
- Glioma (2)
- Huntington's disease (2)
- Insulin signaling pathway (2)
- Long-term depression (2)
- Long-term potentiation (2)
- Melanoma (2)
- Neurotrophin signaling pathway (2)
- Non-small cell lung cancer (2)
- Nucleotide excision repair (2)
- Pancreatic cancer (2)
- Progesterone-mediated oocyte maturation (2)
- Small cell lung cancer (2)
- T cell receptor signaling pathway (2)
- Taste transduction (2)
- Thyroid cancer (2)
- Toll-like receptor signaling pathway (2)
- VEGF signaling pathway (2)
- ABC transporters (1)
- Acute myeloid leukemia (1)
- Adherens junction (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Arachidonic acid metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- DNA replication (1)
- Dilated cardiomyopathy (1)
- Dorso-ventral axis formation (1)
- ECM-receptor interaction (1)
- Endocytosis (1)
- ErbB signaling pathway (1)
- Fatty acid biosynthesis (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- GnRH signaling pathway (1)
- Hematopoietic cell lineage (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Lysosome (1)
- Mismatch repair (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Olfactory transduction (1)
- Oocyte meiosis (1)
- Parkinson's disease (1)
- Pathogenic Escherichia coli infection (1)
- Phosphatidylinositol signaling system (1)
- Prion diseases (1)
- Purine metabolism (1)
- Renal cell carcinoma (1)
- Renin-angiotensin system (1)
- Ribosome (1)
- Vibrio cholerae infection (1)
- p53 signaling pathway (1)