Antibodies

View as table Download

Rabbit anti-HSP90AB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human HSP90AB1

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1

Mouse Monoclonal anti-HSP90AB1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit monoclonal antibody against Cdc25C(E302)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit polyclonal HSP90B (Ab-254) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E).

Rabbit polyclonal Cyclin B1 (Ab-126) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S).

Rabbit polyclonal anti-Cyclin A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-Cyclin-A Antibody was produced by repeated immunizations with a recombinant protein corresponding to the human cyclin A.

Rabbit Polyclonal Cyclin B1 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal Cyclin B1 (Ser147) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 147 (A-F-SP-D-V).
Modifications Phospho-specific

CDK1 / CDC2 Mouse Monoclonal (26E11) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Cyclin B1 (CCNB1) pSer147 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic phosphopeptide derived from human Cyclin B1 around the phosphorylation site of Serine 147 (A-F-Sp-D-V).

Cyclin B1 (CCNB1) pSer147 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic phosphopeptide derived from human Cyclin B1 around the phosphorylation site of Serine 147 (A-F-Sp-D-V).

Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E).
Modifications Phospho-specific

Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K).
Modifications Phospho-specific

Rabbit polyclonal anti-APC1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human APC1.

Anti-CCNB1 (phospho-Ser147) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Serine 147 (A-F-S(p)-D-V) derived from Human Cyclin B1.
Modifications Phospho-specific

Anti-CDC25C Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.214~218 (S-P-S-M-P) derived from Human cdc25C.

Rabbit polyclonal HSP90AB1 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1.

Rabbit polyclonal HSP90AB1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1.

Rabbit Polyclonal Anti-CDK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM

Rabbit Polyclonal HSP90 beta Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Hsp90B protein (between residues 650-724) [UniProt P08238]

CDK1 mouse monoclonal antibody, clone IMD-34, Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat

Apc1 (ANAPC1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat

HSP90AB1 (250-325) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide between aa 250-325 in the sequence of human Hsp90

Cyclin B1 (CCNB1) (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 248-275 amino acids from the Central region of human CCNB1

Cyclin B1 (CCNB1) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 388-418 amino acids from the C-terminal region of human CCNB1

Rabbit Polyclonal Antibody against CDC2 (T14)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1.

Rabbit Polyclonal APC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human APC1.

Rabbit polyclonal Cyclin B1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Anti-Cyclin B1 antibody was produced by repeated immunizations of full length fusion protein corresponding to the human gene.

Rabbit polyclonal APC1 phospho S377 antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 373-382 of Human Apc1 protein.
Modifications Phospho-specific

Rabbit Polyclonal HSP90 beta Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human Hsp90B protein (between residues 1-50) [UniProt P08238]

Rabbit anti CDC2 Polyclonal Antibody

Applications IHC, WB
Reactivities Bovine, Chicken, Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins

CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Mouse Monoclonal anti-HSP90AB1 Antibody

Applications IHC
Reactivities Humann, Rabbit, Rat, Mouse, Chicken
Conjugation Unconjugated

Rabbit polyclonal APC1(Ser355) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human APC1 around the phosphorylation site of serine 355 (A-H-SP-P-A).
Modifications Phospho-specific

Mouse monoclonal Hsp90 Antibody

Applications IHC
Reactivities Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line
Conjugation Unconjugated

Anti-CDK1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1

Anti-CCNB1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 61-74 amino acids of Human cyclin B1

Anti-CCNB2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human cyclin B2

Anti-CCNB2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-58 amino acids of Human G2/mitotic-specific cyclin-B2

Rabbit Polyclonal Anti-ANAPC1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ANAPC1