Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Anti-PARD6A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-EAP30 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
Rabbit Polyclonal Anti-WWP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MDM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MDM2 |
Rabbit Polyclonal Anti-DNM2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DNM2 |
MDM2 mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MDM2 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6), Biotinylated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6), HRP conjugated
| Applications | IHC |
| Reactivities | Human |
| Conjugation | HRP |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Families
- Transcription Factors
Pathways
- Endocytosis