Rabbit Polyclonal Anti-PARD6A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARD6A |
Rabbit Polyclonal Anti-PARD6A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARD6A |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
MDM2 mouse monoclonal antibody, clone 1A7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against MDM2 (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Goat Polyclonal Antibody against VPS25
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1. |
Rabbit polyclonal anti-MDM2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MDM2. |
TSG101 (201-281) mouse monoclonal antibody, clone 5B7, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Anti-CBL (phospho-Tyr700) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 770 (T-E-Y(p)-M-T) derived from Human c-Cbl. |
Modifications | Phospho-specific |
Anti-PARD6A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
MDM2 pSer166 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthesized phosphopeptide derived from human MDM2 around the phosphorylation site of Serine 166 (A-I-SP-E-T) |
MDM2 pSer166 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthesized phosphopeptide derived from human MDM2 around the phosphorylation site of Serine 166 (A-I-SP-E-T) |
TSG101 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
Modifications | Phospho-specific |
SMURF 2 (SMURF2) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SMURF2. |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-EAP30 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF |
Rabbit Polyclonal Anti-WWP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT |
Mouse monoclonal Anti-MDM2 Clone SMP14
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CBL rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
CBL rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
Goat Polyclonal Antibody against PARD6A
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GSRIRGDGSGFSL, from the C Terminus of the protein sequence according to NP_058644. |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI17B3 (formerly 17B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI7F7 (formerly 7F7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI22D6 (formerly 22D6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI15F3 (formerly 15F3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MDM2 mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MDM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MDM2 |
Rabbit Polyclonal Anti-SMURF2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMURF2 |
Rabbit Polyclonal Anti-DNM2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DNM2 |
Rabbit Polyclonal Anti-VPS4B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS4B |
Rabbit Polyclonal Anti-VPS36 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS36 |
MDM2 mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MDM2 mouse monoclonal antibody,clone 1E5, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MDM2 mouse monoclonal antibody,clone 1E5, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MDM2 mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MDM2 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
MDM2 mouse monoclonal antibody,clone 1E6, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MDM2 mouse monoclonal antibody,clone 1E6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
MDM2 mouse monoclonal antibody, clone OTI1E6 (formerly 1E6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6), Biotinylated
Applications | IHC |
Reactivities | Human |
Conjugation | Biotin |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6), HRP conjugated
Applications | IHC |
Reactivities | Human |
Conjugation | HRP |
MDM2 mouse monoclonal antibody, clone OTI8C6 (formerly 8C6)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
MDM2 mouse monoclonal antibody, clone OTI17B3 (formerly 17B3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MDM2 mouse monoclonal antibody, clone OTI17B3 (formerly 17B3), Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
MDM2 mouse monoclonal antibody, clone OTI17B3 (formerly 17B3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |