Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 186 results

Page 1 of 4

(reset)

TNF alpha (TNF) Rabbit Polyclonal Antibody

AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

1 / 2

2 / 2

Previous Next

CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: DJ130c]

AM01321PU-N

USD 475.00

5 Days

CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified

Applications	FC, IHC
Reactivities	Human

HLA-DPB1 Rabbit Polyclonal Antibody

TA327043

USD 275.00

3 Weeks

Rabbit anti-HLA-DPB1 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant protein of human HLA-DPB1

1 / 3

2 / 3

3 / 3

Previous Next

Integrin alpha E (ITGAE) Mouse Monoclonal Antibody [Clone ID: B-ly7]

AM39027PU-N

USD 300.00

In Stock

Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified

Applications	FC, IHC
Reactivities	Human

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human TNFA.

1 / 2

2 / 2

Previous Next

CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]

AM12006AF-N

USD 220.00

2 Weeks

CD28 mouse monoclonal antibody, clone CD28.2, Azide Free

Applications	FC, FN, IF, IHC, IP, WB
Reactivities	Human, Primate

Neutrophil Elastase (ELANE) Sheep Polyclonal Antibody

AP23184PU-N

USD 680.00

5 Days

Neutrophil Elastase sheep polyclonal antibody, Ion exchange chromatography

Applications	ELISA, Ie, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Neutrophil elastase (active-site blocked) prepared from human sputum.

AP23184PU-N is a possible alternative to AP00714PU-N.

CD40 Rabbit Polyclonal Antibody

TA311665

USD 345.00

4 Weeks

Rabbit polyclonal anti-CD40 antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human CD40.

1 / 3

2 / 3

3 / 3

Previous Next

CD28 Mouse Monoclonal Antibody [Clone ID: CD28.2]

AM12006PU-N

USD 220.00

2 Weeks

CD28 mouse monoclonal antibody, clone CD28.2, Purified

Applications	FC, FN, IF, IHC, IP, WB
Reactivities	Human, Primate

CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: c127]

AM26063PU-N

USD 435.00

2 Weeks

CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified

Applications	FC, IHC, IP
Reactivities	Human

NMDAR2B (GRIN2B) Mouse Monoclonal Antibody [Clone ID: S59-20]

TA309447

USD 410.00

In Stock

Mouse Monoclonal anti-NR2B Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

CD40L (CD40LG) (N-term) Rabbit Polyclonal Antibody

AP23309PU-N

USD 405.00

2 Weeks

CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L

1 / 2

2 / 2

Previous Next

NMDAR2A (GRIN2A) (C-term) Rabbit Polyclonal Antibody

AP51953PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.

1 / 3

2 / 3

3 / 3

Previous Next

CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: GRM1]

AM08159PU-N

USD 190.00

3 Days

CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified

Applications	FC, IHC, IP, WB
Reactivities	Human

CD40 Mouse Monoclonal Antibody [Clone ID: B-B20]

AM31223AF-N

USD 270.00

2 Weeks

CD40 mouse monoclonal antibody, clone B-B20, Azide Free

Applications	FC, FN, IHC
Reactivities	Human

1 / 2

2 / 2

Previous Next

CD40L (CD40LG) Mouse Monoclonal Antibody [Clone ID: B-B29]

AM31238AF-N

USD 270.00

2 Weeks

CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Azide Free

Applications	FC, IHC
Reactivities	Human

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) (1-234) Mouse Monoclonal Antibody [Clone ID: M1-C4]

AM31768PU-N

USD 480.00

2 Weeks

TNF alpha (TNF) (1-234) mouse monoclonal antibody, clone M1-C4, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Rat

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

CD40 (C-term) Rabbit Polyclonal Antibody

AP31189PU-N

USD 440.00

2 Weeks

CD40 (C-term) rabbit polyclonal antibody, Purified

Applications	IHC, IP, WB
Reactivities	Human, Mouse, Rat
Immunogen	CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40

NMDAR2B (GRIN2B) Rabbit Polyclonal Antibody

TA313307

USD 345.00

In Stock

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 11C12]

TA355080

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [11C12]

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 12D9]

TA355082

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [12D9]

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]

AM31233AF-N

USD 270.00

2 Weeks

CD28 mouse monoclonal antibody, clone B-T3, Azide Free

Applications	FC, FN, IHC
Reactivities	Human

HLA-DOA Rabbit Polyclonal Antibody

AP21064PU-N

USD 370.00

2 Weeks

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human

1 / 2

2 / 2

Previous Next

NMDAR2B (GRIN2B) (N-term) Rabbit Polyclonal Antibody

AP23268PU-N

USD 405.00

2 Weeks

NMDAR2B (GRIN2B) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Peptide mapping at the N-terminus of NMDAR2B of human origin

HLA DMB (HLA-DMB) Rabbit Polyclonal Antibody

TA308239

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Goat Polyclonal Antibody

TA328454

USD 285.00

5 Days

Anti-Human TNF-a Goat Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

B7-1 (CD80) Rabbit Polyclonal Antibody

TA355032

USD 430.00

5 Days

Rabbit Polyclonal Anti-CD80 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80.

1 / 3

2 / 3

3 / 3

Previous Next

B7-2 (CD86) Rabbit Polyclonal Antibody

TA355033

USD 430.00

5 Days

Rabbit Polyclonal Anti-CD86 Antibody

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86.

1 / 3

2 / 3

3 / 3

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 8G12]

TA355072

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [8G12]

Applications	FC, IF, IHC
Reactivities	Human
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 10A1]

TA355074

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [10A1]

Applications	FC, IF, IHC
Reactivities	Human
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 11D1]

TA355078

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [11D1]

Applications	FC, IF, IHC
Reactivities	Human
Conjugation	Unconjugated

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

CD28 Mouse Monoclonal Antibody [Clone ID: B-T3]

AM31233PU-N

USD 250.00

2 Weeks

CD28 mouse monoclonal antibody, clone B-T3, Purified

Applications	FC, IHC
Reactivities	Human

NMDAR2A (GRIN2A) (Center) Rabbit Polyclonal Antibody

AP51952PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A

1 / 2

2 / 2

Previous Next

HLA-DRB5 (Center) Rabbit Polyclonal Antibody

AP52055PU-N

USD 450.00

2 Weeks

HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5

1 / 2

2 / 2

Previous Next

CD32B (FCGR2B) Goat Polyclonal Antibody

TA302446

USD 375.00

5 Days

Goat Polyclonal Antibody against CD32 / FCGR2B

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-PDALEEPDDQNRI, from the C Terminus of the protein sequence according to NP_003992.3; NP_001002273.1; NP_001002274.1; NP_001002275.1;.

1 / 3

2 / 3

3 / 3

Previous Next

HLA DM (HLA-DMA) Rabbit Polyclonal Antibody

TA308310

USD 415.00

5 Days

Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)

Applications	IHC, WB
Reactivities	Human
Immunogen	Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications	IHC, WB
Reactivities	Human, Primate
Conjugation	Unconjugated
Immunogen	The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.

1 / 3

2 / 3

3 / 3

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA328455

USD 285.00

5 Days

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	E.coli derived Recombinant Human TNF-α

1 / 2

2 / 2

Previous Next

Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody

TA334645

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA

1 / 2

2 / 2

Previous Next

Complement factor 8 beta (C8B) Rabbit Polyclonal Antibody

TA334646

USD 375.00

5 Days

Rabbit Polyclonal Anti-C8B Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL

1 / 2

2 / 2

Previous Next

TNF alpha (TNF) Rabbit Polyclonal Antibody

TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody

TA338510

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST

1 / 2

2 / 2

Previous Next

B7-1 (CD80) Mouse Monoclonal Antibody [Clone ID: 7A2]

TA355076

USD 500.00

5 Days

Mouse Monoclonal Anti-CD80 Antibody [7A2]

Applications	IF, IHC
Reactivities	Human
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI9C6]

CF500645

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI9C6 (formerly 9C6)

Applications	IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI19C10]

CF500647

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI19C10 (formerly 19C10)

Applications	FC, IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI13D7]

CF500648

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI13D7 (formerly 13D7)

Applications	IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI6H7]

CF500649

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI6H7 (formerly 6H7)

Applications	IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI9G5]

CF500652

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI9G5 (formerly 9G5)

Applications	IF, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD32A (FCGR2A) Mouse Monoclonal Antibody [Clone ID: OTI6D11]

CF500653

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) FCGR2A mouse monoclonal antibody, clone OTI6D11 (formerly 6D11)

Applications	FC, IHC, IP, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 50 of 186 results

Page 1 of 4