Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to ATPase beta3 (Na+/K+) (ATPase, Na+/K+ transporting, beta 3 polypeptide)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 53 and 279 of ATPase beta3 (Na+/K+) (Uniprot ID#P54709) |
Rabbit Polyclonal Anti-ATP1B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP1B1 antibody: synthetic peptide directed towards the middle region of human ATP1B1. Synthetic peptide located within the following region: VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Rabbit polyclonal anti-COX5B antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX5B. |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gibbon (94%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ATP1B3 antibody was raised against synthetic 17 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset (100%); Guinea pig (94%); Rabbit, Lizard (88%); Elephant, Panda, Bat, Bovine, Dog, Horse, Pig, Turkey, Chicken, Xenopus (82%). |
Rabbit Polyclonal Anti-ATP1B3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ATP1B3 antibody was raised against synthetic 18 amino acid peptide from internal region of human ATP1B3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Bovine, Horse, Rabbit (100%); Elephant, Bat, Pig, Guinea pig (94%); Galago, Platypus (83%). |
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) TNNC1 mouse monoclonal antibody, clone OTI9D4 (formerly 9D4)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) TNNC1 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-207 amino acids of Human tropomyosin 2 (beta) |
Anti-TPM2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 270-284 amino acids of human tropomyosin 2 (beta) |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-COX7B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 897-911 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-ATP1A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 28-40 amino acids of human ATPase, Na+/K+ transporting, alpha 1 polypeptide |
Anti-TPM1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-TNNI3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-MYH7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human myosin, heavy chain 7, cardiac muscle, beta |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Pathways
- Cardiac muscle contraction
Filter by
Target Symbol
- TNNT2 (38)
- TNNI3 (32)
- TNNC1 (24)
- COX6C (10)
- COX4I1 (8)
- TPM2 (7)
- TPM1 (6)
- UQCRC1 (6)
- UQCRFS1 (6)
- ATP1B3 (5)
- ATP1A1 (4)
- CACNA1C (4)
- COX6B1 (4)
- MYH7 (3)
- MYL2 (3)
- SLC9A1 (3)
- ACTC1 (2)
- ATP1B1 (2)
- ATP1B2 (2)
- CACNA2D2 (2)
- CACNB1 (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- RYR2 (2)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNB2 (1)
- CACNG5 (1)
- CACNG6 (1)
- CACNG8 (1)
- COX6A1 (1)
- COX6A2 (1)
- COX6B2 (1)
- COX7A2 (1)
- COX7A2L (1)
- COX8A (1)
- LCMT2 (1)
- MYL3 (1)
- UQCR10 (1)
- UQCRB (1)
- UQCRC2 (1)