Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

51 - 100 of 250 results

Page 2 of 5

(reset)

GSTM1 (1-159) Rabbit Polyclonal Antibody

AP23586PU-N

USD 440.00

2 Weeks

GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse
Immunogen	Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1

1 / 3

2 / 3

3 / 3

Previous Next

Isocitrate dehydrogenase (IDH1) (30-307) Rabbit Polyclonal Antibody

AP23607PU-N

USD 440.00

2 Weeks

Isocitrate dehydrogenase (IDH1) (30-307) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	Recombinant protein fragment containing a sequence corresponding to a region within amino acids 30 and 307 of Human isocitrate dehydrogenase

1 / 3

2 / 3

3 / 3

Previous Next

GSTA2 (N-term) Rabbit Polyclonal Antibody

AP51964PU-N

USD 450.00

2 Weeks

GSTA2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human GSTA2 / GST2.

1 / 2

2 / 2

Previous Next

Glutathione Peroxidase 1 (GPX1) Goat Polyclonal Antibody

TA303116

USD 375.00

5 Days

Goat Polyclonal Antibody against GPX1

Applications	IHC, WB
Reactivities	Human, Pig
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2.

1 / 3

2 / 3

3 / 3

Previous Next

GSTA4 Rabbit Polyclonal Antibody

TA307976

USD 415.00

5 Days

Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217)

1 / 2

2 / 2

Previous Next

Glutathione Peroxidase 7 (GPX7) Rabbit Polyclonal Antibody

TA308073

USD 415.00

5 Days

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

1 / 2

2 / 2

Previous Next

GGT1 Rabbit Polyclonal Antibody

TA308190

USD 415.00

5 Days

Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440)

1 / 3

2 / 3

3 / 3

Previous Next

glutathione S transferase Omega 1 (GSTO1) Rabbit Polyclonal Antibody

TA308286

USD 415.00

5 Days

Rabbit Polyclonal antibody to GSTO1 (glutathione S-transferase omega 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 30 and 241 of GSTO1 (Uniprot ID#P78417)

1 / 2

2 / 2

Previous Next

Glutathione S Transferase theta 1 (GSTT1) Rabbit Polyclonal Antibody

TA308416

USD 415.00

5 Days

Rabbit polyclonal antibody to GSTT1 (glutathione S-transferase theta 1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 240 of GSTT1 (Uniprot ID#P30711)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GCLM Rabbit Polyclonal Antibody

TA335034

USD 375.00

5 Days

Rabbit Polyclonal Anti-GCLM Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI2E3]

CF501829

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI6B7]

CF501830

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

CF501832

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI7A12]

CF501858

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI9A1]

CF501881

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI6C4]

CF501883

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

GSTA4 Mouse Monoclonal Antibody [Clone ID: OTI3F5]

CF501903

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI1A12]

CF501932

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

CF501933

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI1B8]

CF502094

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF503091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5F2]

CF503098

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF503099

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

GSTO2 Mouse Monoclonal Antibody [Clone ID: OTI2A12]

CF504083

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GSTO2 Mouse Monoclonal Antibody [Clone ID: OTI3A9]

CF504087

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF505578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

GCLC Mouse Monoclonal Antibody [Clone ID: OTI1A3]

CF507318

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI3G9]

CF800406

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI24A2]

CF800426

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI1D1]

CF800427

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI5G5]

CF801208

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GST3 (GSTP1) Mouse Monoclonal Antibody [Clone ID: OTI4B6]

CF801775

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

GST3 (GSTP1) Mouse Monoclonal Antibody [Clone ID: OTI10H1]

CF801776

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI6G8]

CF804382

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody,clone OTI6G8

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI1F9]

CF804454

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI16A8]

CF804537

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) RRM1 mouse monoclonal antibody, clone OTI16A8 (formerly 16A8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI17C3]

CF804723

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI17C3 (formerly 17C3)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

RRM1 Mouse Monoclonal Antibody [Clone ID: OTI2D10]

CF804875

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF807395

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF807396

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

CD13 (ANPEP) Mouse Monoclonal Antibody [Clone ID: OTI3F8]

CF807397

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

RRM2 Mouse Monoclonal Antibody [Clone ID: OTI3D3]

CF810467

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI3D3

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

RRM2 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

CF810548

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI1F2

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Ornithine Decarboxylase (ODC1) Rabbit Polyclonal Antibody

TA321500

USD 345.00

In Stock

Anti-ODC1 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 300 amino acids of human ornithine decarboxylase 1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

RRM1 Rabbit Polyclonal Antibody

TA323395

USD 345.00

In Stock

Anti-RRM1 Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1

Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

TA323576

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

TA323577

USD 345.00

In Stock

Anti-GSR Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Isocitrate dehydrogenase (IDH1) Rabbit Polyclonal Antibody

TA349598

USD 345.00

In Stock

Rabbit Polyclonal Anti-IDH1 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human IDH1

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GSTA2 Rabbit Polyclonal Antibody

TA349631

USD 345.00

In Stock

Rabbit Polyclonal Anti-GSTA2 Antibody

Applications	IHC
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Fusion protein of human GSTA2

51 - 100 of 250 results

Page 2 of 5