GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1 |
GSTM1 (1-159) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 159 of Human GSTM1 |
Isocitrate dehydrogenase (IDH1) (30-307) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 30 and 307 of Human isocitrate dehydrogenase |
GSTA2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human GSTA2 / GST2. |
Goat Polyclonal Antibody against GPX1
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-REALPAPSDDATA, from the internal region of the protein sequence according to NP_000572.2. |
Rabbit Polyclonal antibody to GSTA4 (glutathione S-transferase alpha 4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 222 of GSTA4 (Uniprot ID#O15217) |
Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4) |
Rabbit Polyclonal antibody to GGT1 (gamma-glutamyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 226 of GGT1 (Uniprot ID#P19440) |
Rabbit Polyclonal antibody to GSTO1 (glutathione S-transferase omega 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 30 and 241 of GSTO1 (Uniprot ID#P78417) |
Rabbit polyclonal antibody to GSTT1 (glutathione S-transferase theta 1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 240 of GSTT1 (Uniprot ID#P30711) |
Rabbit Polyclonal Anti-GCLM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI7A12 (formerly 7A12)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTA4 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GCLC mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI24A2 (formerly 24A2)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI5G5 (formerly 5G5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTP1 mouse monoclonal antibody, clone OTI10H1 (formerly 10H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody,clone OTI6G8
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI1F9 (formerly 1F9)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) RRM1 mouse monoclonal antibody, clone OTI16A8 (formerly 16A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI17C3 (formerly 17C3)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM1 mouse monoclonal antibody, clone OTI2D10 (formerly 2D10)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2E4 (formerly 2E4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANPEP mouse monoclonal antibody, clone OTI3F8 (formerly 3F8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI3D3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RRM2 mouse monoclonal antibody,clone OTI1F2
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ODC1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human ornithine decarboxylase 1 |
Anti-RRM1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1 |
Anti-GSR Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase |
Anti-GSR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 274-475 amino acids of human glutathione reductase |
Rabbit Polyclonal Anti-IDH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDH1 |
Rabbit Polyclonal Anti-GSTA2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GSTA2 |