Rabbit Polyclonal Anti-UMPS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS. Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII |
Rabbit Polyclonal Anti-CES2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CES2 antibody: synthetic peptide directed towards the C terminal of human CES2. Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal TK (Ab-13) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
Rabbit polyclonal ITPA Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-51 amino acids from the N-terminal region of human ITPA. |
Rabbit Polyclonal antibody to UGT1A6 (UDP glucuronosyltransferase 1 family, polypeptide A6)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 227 of UGT1A6 (Uniprot ID#P19224) |
Rabbit polyclonal TK (Ser13) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TK around the phosphorylation site of serine 13 (P-G-SP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit polyclonal Anti-UGT1A7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UGT1A7 antibody: synthetic peptide directed towards the N terminal of human UGT1A7. Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
Rabbit Polyclonal Anti-GUSB Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GUSB antibody: synthetic peptide directed towards the C terminal of human GUSB. Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF |
Rabbit Polyclonal Anti-IMPDH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE |
USD 1,140.00
9 Weeks
USD 1,140.00
9 Weeks
USD 1,140.00
2 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
4 Weeks
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Rabbit Polyclonal Anti-UCK1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human UCK1 |
Rabbit Polyclonal Anti-IMPDH2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IMPDH2 |
Germany
Japan
United Kingdom
China
