Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Mouse Monoclonal NAK Antibody (108A429)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine |
| Conjugation | Unconjugated |
TA336453 is a replacement of AM08296PU-N.
USD 310.00
2 Weeks
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
USD 340.00
2 Weeks
USD 360.00
2 Weeks
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665] |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal beta-Arrestin 2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1. |
Rabbit Polyclonal GRAIL/RNF128 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Canine, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1. |
Rabbit Polyclonal Anti-NUCB2 Antibody
| Applications | IHC, WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE |
LAMP3 rat monoclonal antibody, clone 1010E1.01
| Applications | FC, IHC |
| Reactivities | Canine, Feline, Human, Mouse, Sheep |
| Conjugation | Biotin |
MYD88 mouse monoclonal antibody, clone 603E10.05
| Applications | FC, IHC |
| Reactivities | Canine, Human, Porcine |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Canine
Applications
- IHC
Filter by
Category
Target Symbol
- RAB27A (5)
- RAB11A (3)
- CASP9 (2)
- CTSD (2)
- HSPD1 (2)
- ACAN (1)
- AGR2 (1)
- AIFM1 (1)
- AMPD1 (1)
- ANGPT1 (1)
- ARRB2 (1)
- ATP1A1 (1)
- BECN1 (1)
- CASP3 (1)
- CASP6 (1)
- FKBP4 (1)
- FTCD (1)
- GPR83 (1)
- HDAC9 (1)
- HIF1A (1)
- HIPK3 (1)
- HOXA9 (1)
- HSPA1A (1)
- HSPE1 (1)
- IFRD1 (1)
- MSR1 (1)
- NQO1 (1)
- NUCB2 (1)
- PLK1 (1)
- PRKCA (1)
- RAB11B (1)
- RAB25 (1)
- RAB27B (1)
- RAB7A (1)
- RNF128 (1)
- S1PR5 (1)
- SCARB2 (1)
- SFN (1)
- SMAD2 (1)
- SOD2 (1)
- SOX9 (1)
- SRI (1)
- TACR3 (1)
- TBK1 (1)
- TJP1 (1)
- TLR3 (1)
- TLR5 (1)
- TLR9 (1)
- TUBB (1)
- VEGFA (1)
Antibody Hosts
Clonalities
Conjugates
Families
- Druggable Genome (49)
- Transmembrane (11)
- Transcription Factors (7)
- Protease (6)
- Stem cell - Pluripotency (6)
- ES Cell Differentiation/IPS (5)
- Secreted Protein (5)
- Protein Kinase (4)
- Embryonic stem cells (2)
- GPCR (2)
- Adult stem cells (1)
- Cancer stem cells (1)
- Induced pluripotent stem cells (1)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
Pathways
- Pathways in cancer (7)
- Endocytosis (6)
- Apoptosis (5)
- Colorectal cancer (4)
- Huntington's disease (4)
- MAPK signaling pathway (4)
- Pancreatic cancer (4)
- Toll-like receptor signaling pathway (4)
- VEGF signaling pathway (4)
- p53 signaling pathway (4)
- Alzheimer's disease (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Cell cycle (3)
- Gap junction (3)
- Lysosome (3)
- Non-small cell lung cancer (3)
- Parkinson's disease (3)
- Pathogenic Escherichia coli infection (3)
- Viral myocarditis (3)
- Adherens junction (2)
- Endometrial cancer (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- Focal adhesion (2)
- Metabolic pathways (2)
- Natural killer cell mediated cytotoxicity (2)
- Neuroactive ligand-receptor interaction (2)
- Prostate cancer (2)
- RNA degradation (2)
- Renal cell carcinoma (2)
- Small cell lung cancer (2)
- Tight junction (2)
- Type I diabetes mellitus (2)
- Vibrio cholerae infection (2)
- Wnt signaling pathway (2)
- mTOR signaling pathway (2)
- Antigen processing and presentation (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cardiac muscle contraction (1)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- Cytosolic DNA-sensing pathway (1)
- ErbB signaling pathway (1)
- Fc epsilon RI signaling pathway (1)
- Fc gamma R-mediated phagocytosis (1)
- Glioma (1)
- GnRH signaling pathway (1)
- Histidine metabolism (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Melanogenesis (1)
- Olfactory transduction (1)
- One carbon pool by folate (1)
- Oocyte meiosis (1)
- Phosphatidylinositol signaling system (1)
- Prion diseases (1)
- Progesterone-mediated oocyte maturation (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Regulation of autophagy (1)
- Spliceosome (1)
- TGF-beta signaling pathway (1)
- Vascular smooth muscle contraction (1)