Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Rabbit Polyclonal anti-Elongin C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full-length |
Rabbit polyclonal antibody to UBE2G2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 165 of UBE2G2 (Uniprot ID#P60604) |
Rabbit Polyclonal XIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Rabbit Polyclonal KEAP1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal CUL4B Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal XIAP (Ser87) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP around the phosphorylation site of Serine 87 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against SOCS3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PIREFLDQYDAPL, from the C Terminus of the protein sequence according to NP_003946.3. |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TRIM32 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the C terminal of human TRIM32. Synthetic peptide located within the following region: GFSIGSVGPDGQLGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKE |
Goat Polyclonal Anti-STUB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human STUB1 protein produced in E. coli. |
Goat Polyclonal Antibody against VHL
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSLVKPENYRRLD, from the internal region of the protein sequence according to NP_000542.1; NP_937799.1. |
Rabbit polyclonal anti-CDC20 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC20. |
Rabbit polyclonal anti-H-NUC antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human H-NUC. |
Rabbit polyclonal AIRE (Ser156) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AIRE around the phosphorylation site of serine 156 (P-G-SP-Q-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ser1457) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1457 (L-T-SP-Q-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-UBE2D2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human UBE2D2. |
Rabbit polyclonal anti-RHBT2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RHBT2. |
Rabbit polyclonal anti-ANAPC5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ANAPC5. |
Rabbit polyclonal anti-RFWD2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RFWD2. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Active filters
Category
- Antibodies
Applications
- WB
Isotypes
- IgG
Pathways
- Ubiquitin mediated proteolysis
Availabilities
- In Stock
Filter by
Target Symbol
- BRCA1 (5)
- MDM2 (5)
- CBL (4)
- XIAP (4)
- CDC20 (3)
- SOCS1 (3)
- TRIM32 (3)
- ANAPC5 (2)
- BIRC2 (2)
- CDC16 (2)
- CDC27 (2)
- CUL2 (2)
- CUL4B (2)
- DDB1 (2)
- ELOC (2)
- KEAP1 (2)
- PIAS1 (2)
- PIAS3 (2)
- SAE1 (2)
- SKP1 (2)
- SOCS3 (2)
- UBA1 (2)
- UBE2S (2)
- VHL (2)
- AIRE (1)
- ANAPC13 (1)
- ANAPC2 (1)
- ANAPC4 (1)
- CDC23 (1)
- CDC34 (1)
- COP1 (1)
- CUL1 (1)
- CUL3 (1)
- CUL4A (1)
- FANCL (1)
- HUWE1 (1)
- ITCH (1)
- KLHL9 (1)
- MAP3K1 (1)
- MID1 (1)
- NEDD4 (1)
- PIAS2 (1)
- PML (1)
- PRKN (1)
- RHOBTB2 (1)
- RNF7 (1)
- STUB1 (1)
- SYVN1 (1)
- TRAF6 (1)
- UBA7 (1)
- UBE2D2 (1)
- UBE2G2 (1)
- UBE2I (1)
- UBE2L3 (1)
- UBR5 (1)