Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Goat Polyclonal Anti-NPHS2 / SRN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1. |
Goat Polyclonal Antibody against WNT4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit polyclonal anti-FZD10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD10. |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit anti-EDNRB Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human EDNRB |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Goat Polyclonal Antibody against FZD7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1. |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
Rabbit polyclonal anti-FZD8 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD8 |
Rabbit polyclonal anti-FZD9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human FZD9. |
Rabbit polyclonal FZD1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FZD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of human FZD1. |
Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721. |
| Modifications | Phospho-specific |
Rabbit Polyclonal KIT Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human KIT. |
Rabbit polyclonal anti-ADCY1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY1. |
Anti-FZD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2 |
Anti-WNT9A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-FZD1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human frizzled family receptor 1 |
Rabbit polyclonal WNT16 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16. |
Rabbit Polyclonal c-Kit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Kit |
Goat Anti-WNT15 / WNT9B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KRGNKDLRARADA, from the internal region of the protein sequence according to NP_003387.1. |
Rabbit polyclonal anti-ADCY4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
Rabbit polyclonal anti-Wnt1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Macaque, Mouse, Opossum, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human Wnt1 protein. |
Anti-KIT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.719~723 (N-E-Y-M-D) derived from Human c-Kit. |
Rabbit Polyclonal Anti-WNT1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT1 antibody: synthetic peptide directed towards the middle region of human WNT1. Synthetic peptide located within the following region: FGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTV |
Rabbit Polyclonal Anti-WNT4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT4 antibody: synthetic peptide directed towards the middle region of human WNT4. Synthetic peptide located within the following region: HGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNE |
Phospho-KIT-Y721 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y721 of human KIT |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the N terminal of human TYRP1. Synthetic peptide located within the following region: AKRTTHPLFVIATRRSEEILGPDGNTPQFENISIYNYFVWTHYYSVKKTF |
Rabbit Polyclonal Frizzled-10 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Primate |
| Conjugation | Unconjugated |
| Immunogen | A portion of amino acid 150-200 of human Frizzled-10 was used as the immunogen |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Anti-MC1R Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 301-315 amino acids of Human melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor) |
Anti-WNT9A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A |
Anti-FZD4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 37-222 amino acids of human frizzled family receptor 4 |
Anti-ADCY1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain) |
Anti-EDNRB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 70-84 amino acids of human endothelin receptor type B |
Active filters
Reactivities
- Mouse
Applications
- WB
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Melanogenesis