Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-FZD7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit Polyclonal Anti-ITGB1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB1 |
Rabbit anti-CDH1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CDH1 |
MCSF Receptor (CSF1R) (531-580) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to amino acids 531-580 of Human c-Fms |
Rabbit polyclonal ERBB2 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ErbB2 antibody is generated from rabbits immunized with human recombinant ErbB2 protein. |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
FGFR1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FGFR1 |
Rabbit Polyclonal Anti-Ret (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CEWRQGDGKGITR, corresponding to amino acid residues 541-553 of human Ret. Extracellular, N-terminus. |
E Cadherin (CDH1) mouse monoclonal antibody, clone 3F4, Purified
Applications | ELISA, IF, IHC, PLA, WB |
Reactivities | Human |
BAX (3-16) mouse monoclonal antibody, clone 2D2, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey |
FLT3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Peptide sequence around amino acids 589~593 (Y-F-Y-V-D) drerived from Human FLT3. |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-TGFR2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
Goat Polyclonal Anti-CDH1 (aa662-675) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CDH1 (aa662-675) Antibody: Peptide with sequence C-DYKINLKLMDNQNK, from the internal region of the protein sequence according to NP_004351.1. |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal anti-GLUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GLUT1. |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit polyclonal anti-FZD9 antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FZD9. |
BCL2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human BCL2 |
Goat Polyclonal Anti-CDH1 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
Applications | Assay, FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal TGFBR2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Rabbit anti-TGFBR2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TGFBR2 |
Rabbit Polyclonal Anti-WNT9B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD |
Rabbit Polyclonal Anti-FZD4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Mouse Monoclonal IL8 Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal CSFR (Ab-809) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal IL8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-PDGFRB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
Modifications | Phospho-specific |
Goat Polyclonal Anti-NPHS2 / SRN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1. |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FGFR1 (837-852) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bat, Bovine, Canine, Equine, Human, Monkey |
Immunogen | Synthetic peptide from C-term of human FGFR1 |
Rabbit Polyclonal Antibody against CSF1R
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Rabbit Polyclonal IGF1 Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human IGF1R protein (between residues 700-800) [UniProt P08069] |
Rabbit polyclonal Ret (Ab-905) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Ret around the phosphorylation site of tyrosine 905 (D-S-YP-V-K). |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
Rabbit Polyclonal Ret (Tyr1062) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Ret around the phosphorylation site of Tyrosine 1062 |
Modifications | Phospho-specific |
ITGAV Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ITGAV |