Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal Anti-HSD3B1 Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Goat Polyclonal Anti-CD31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 690 aa to the C-terminus of human CD31 produced in E. coli. |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Recombinant peptide derived from within residues 601 to 701 of human CDH1 produced in E. coli. |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Serotonin transporter (SLC6A4) (579-599) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide sequence corresponding to amino acids (602–622) of rat 5HT transporter coupled to keyhole limpet hemocyanin (KLH). |
Rabbit Polyclonal Antibody against LINGO1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LINGO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-92 amino acids from the N-terminal region of human LINGO1. |
Rabbit anti-S100A10 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human S100A10 |
Rabbit polyclonal CD38 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38. |
Goat Polyclonal Anti-CDH1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 750 to 850 of human CDH1 produced in E. coli. |
Goat Polyclonal Anti-ERBB2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. |
Rabbit polyclonal LRP12 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LRP12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 635-662 amino acids from the C-terminal region of human LRP12. |
Rabbit polyclonal SLC25A31 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31. |
Goat Polyclonal Anti-STX6 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli. |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Goat Polyclonal Anti-TNF alpha Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Goat Polyclonal Anti-INSR Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 1310 aa to the C-terminus of human INSR produced in E. coli. |
Goat Polyclonal Anti-CD2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant peptide derived from within residues 300 aa to the C-terminus of human CD2 produced in E. coli. |
Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930) |
Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH |
Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody
| Applications | WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit polyclonal anti-ABCB1 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Rabbit polyclonal antibody to alpha Glucosidase II (glucosidase, alpha; neutral AB)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 654 and 944 of alpha Glucosidase II (Uniprot ID#Q14697) |
Active filters
Reactivities
- Monkey
Applications
- WB
Families
- Transmembrane
Filter by
Category
Target Symbol
- CD4 (21)
- LEMD3 (20)
- LMAN1 (20)
- GOLM1 (15)
- ILVBL (15)
- KLK8 (15)
- SIGLEC9 (15)
- BSG (11)
- ALDH3A2 (10)
- APMAP (10)
- CD22 (10)
- FGG (10)
- KCNJ3 (10)
- L1CAM (10)
- NPTN (10)
- PDIA4 (10)
- PMEL (10)
- RPN1 (10)
- SLC2A5 (10)
- SSR1 (10)
- TAPBPL (10)
- TFR2 (10)
- VCAM1 (10)
- CANX (9)
- FOLH1 (8)
- ICAM3 (8)
- CDH2 (6)
- PDCD1 (6)
- A4GNT (5)
- BTN1A1 (5)
- CD1C (5)
- CD3E (5)
- CD5 (5)
- CD80 (5)
- CDCP1 (5)
- CYP2A6 (5)
- ENG (5)
- ENPEP (5)
- FATE1 (5)
- FCGR2A (5)
- M6PR (5)
- MS4A1 (5)
- NCAM1 (5)
- PCDH7 (5)
- PTPN1 (5)
- SERPINB13 (5)
- SHH (5)
- SLC7A8 (5)
- SPG7 (5)
- SPINT1 (5)
- TMEM100 (5)
- TNFRSF10B (5)
- TRPM4 (5)
- UBE2J1 (5)
- VTI1A (5)
- EGFR (4)
- ERBB2 (4)
- BAX (3)
- CD44 (3)
- GJA1 (3)
- CD19 (2)
- CD63 (2)
- CDH1 (2)
- P2RX2 (2)
- PTPRC (2)
- SLC6A3 (2)
- SRD5A2 (2)
- ABCB1 (1)
- APP (1)
- ATP2A2 (1)
- CD1B (1)
- CD1D (1)
- CD2 (1)
- CD36 (1)
- CD38 (1)
- CD40 (1)
- CLGN (1)
- COX4I1 (1)
- GANAB (1)
- HSD3B1 (1)
- HSD3B2 (1)
- ICAM2 (1)
- IL1R2 (1)
- INSR (1)
- KDELR1 (1)
- LINGO1 (1)
- LRP12 (1)
- NAT2 (1)
- PECAM1 (1)
- S100A10 (1)
- SLC25A31 (1)
- SLC6A4 (1)
- STX6 (1)
- TNF (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Pathways
- Cell adhesion molecules (CAMs) (89)
- Hematopoietic cell lineage (63)
- T cell receptor signaling pathway (35)
- Metabolic pathways (31)
- Primary immunodeficiency (31)
- Antigen processing and presentation (30)
- Pathways in cancer (18)
- Adherens junction (16)
- Calcium signaling pathway (13)
- B cell receptor signaling pathway (12)
- Cytokine-cytokine receptor interaction (12)
- Systemic lupus erythematosus (12)
- Leukocyte transendothelial migration (11)
- N-Glycan biosynthesis (11)
- Vibrio cholerae infection (11)
- Arginine and proline metabolism (10)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (10)
- Ascorbate and aldarate metabolism (10)
- Axon guidance (10)
- Bladder cancer (10)
- Butanoate metabolism (10)
- Complement and coagulation cascades (10)
- Endometrial cancer (10)
- Fatty acid metabolism (10)
- Glycerolipid metabolism (10)
- Glycolysis / Gluconeogenesis (10)
- Histidine metabolism (10)
- Limonene and pinene degradation (10)
- Lysine degradation (10)
- Propanoate metabolism (10)
- Prostate cancer (10)
- Pyruvate metabolism (10)
- Tryptophan metabolism (10)
- Valine (10)
- beta-Alanine metabolism (10)
- leucine and isoleucine degradation (10)
- Apoptosis (9)
- Parkinson's disease (9)
- ErbB signaling pathway (8)
- Focal adhesion (8)
- Non-small cell lung cancer (8)
- Pancreatic cancer (8)
- Prion diseases (8)
- p53 signaling pathway (8)
- Allograft rejection (7)
- Colorectal cancer (7)
- Fc gamma R-mediated phagocytosis (7)
- Gap junction (7)
- Lysosome (7)
- Natural killer cell mediated cytotoxicity (7)
- Toll-like receptor signaling pathway (7)
- Autoimmune thyroid disease (6)
- Caffeine metabolism (6)
- Drug metabolism - other enzymes (6)
- Graft-versus-host disease (6)
- Insulin signaling pathway (6)
- MAPK signaling pathway (6)
- Melanoma (6)
- SNARE interactions in vesicular transport (6)
- Type I diabetes mellitus (6)
- Viral myocarditis (6)
- Basal cell carcinoma (5)
- Drug metabolism - cytochrome P450 (5)
- Hedgehog signaling pathway (5)
- Huntington's disease (5)
- Renin-angiotensin system (5)
- Retinol metabolism (5)
- Ubiquitin mediated proteolysis (5)
- Alzheimer's disease (4)
- Amyotrophic lateral sclerosis (ALS) (4)
- Androgen and estrogen metabolism (4)
- Dorso-ventral axis formation (4)
- ECM-receptor interaction (4)
- Endocytosis (4)
- Epithelial cell signaling in Helicobacter pylori infection (4)
- Glioma (4)
- GnRH signaling pathway (4)
- Regulation of actin cytoskeleton (4)
- Neurotrophin signaling pathway (3)
- Adipocytokine signaling pathway (2)
- Asthma (2)
- C21-Steroid hormone metabolism (2)
- Cardiac muscle contraction (2)
- Dilated cardiomyopathy (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Neuroactive ligand-receptor interaction (2)
- Pathogenic Escherichia coli infection (2)
- Thyroid cancer (2)
- Type II diabetes mellitus (2)
- ABC transporters (1)
- Fc epsilon RI signaling pathway (1)
- NOD-like receptor signaling pathway (1)
- Nicotinate and nicotinamide metabolism (1)
- Oxidative phosphorylation (1)
- PPAR signaling pathway (1)
- RIG-I-like receptor signaling pathway (1)
- TGF-beta signaling pathway (1)