Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to PHEX (phosphate regulating endopeptidase homolog, X-linked)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 355 of PHEX (Uniprot ID#P78562) |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit polyclonal Caspase 8 (Tyr380) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 8 around the phosphorylation site of tyrosine 380 (Q-P-YP-L-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-USP40 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP40. |
Cathepsin K Rabbit anti-Rat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K. |
Rabbit polyclonal anti-Furin/PACE antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 779 of mouse Furin/PACE |
Anti-MALT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 125-450 amino acids of human mucosa associated lymphoid tissue lymphoma translocation gene 1 |
Rabbit Polyclonal Caspase 8 (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 8 around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Fish, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Rabbit polyclonal antibody to Dhh (desert hedgehog homolog (Drosophila))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 135 and 396 of Dhh (Uniprot ID#O43323) |
Rabbit polyclonal antibody to XPNPEP2 (X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 198 and 476 of XPNPEP2 (Uniprot ID#O43895) |
Rabbit polyclonal FA10 (activated heavy chain, Cleaved-Ile235) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FA10. |
Rabbit polyclonal FA10 (light chain, Cleaved-Ala41) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human FA10. |
Rabbit polyclonal KLKB1 (heavy chain, Cleaved-Arg390) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human KLKB1.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
| Modifications | Phospho-specific |
Rabbit polyclonal C1R (heavy chain, Cleaved-Arg463) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R heavy chain. |
Rabbit polyclonal C1R (light chain, Cleaved-Ile464) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1R. |
Rabbit polyclonal C1S (heavy chain, Cleaved-Arg437) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human C1S. |
Rabbit polyclonal Cathepsin D (light chain, Cleaved-Gly65) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cathepsin D AND light chain. |
Rabbit polyclonal Cathepsin D (heavy chain, Cleaved-Leu169) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CATD. |
Rabbit polyclonal anti-Cathepsin D antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CTSD. |
Rabbit polyclonal MMP12 (Cleaved-Glu106) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP12. |
Rabbit polyclonal anti-ADAM32 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human ADAM32. |
Rabbit polyclonal CASP5 (p20, Cleaved-Asp121) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP5. |
Rabbit polyclonal CASP5 (p10, Cleaved-Ser331) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP5. |
Rabbit polyclonal anti-USP36 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human USP36. |
Rabbit polyclonal CASP3 (p17, Cleaved-Asp175) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal Caspase 3 (Cleaved-Ser29) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP3. |
Rabbit polyclonal CASP8 (Cleaved-Asp384) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human CASP8. |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Protease
Availabilities
- In Stock
Filter by
Category
Target Symbol
- CASP7 (7)
- CASP9 (7)
- CFLAR (7)
- CASP3 (6)
- CTSD (6)
- CASP8 (5)
- F10 (5)
- CASP1 (4)
- CASP2 (4)
- MME (4)
- MMP11 (4)
- MMP2 (4)
- ACE (3)
- ACR (3)
- ADAM17 (3)
- ADAMTS18 (3)
- ATG4B (3)
- CASP6 (3)
- CTSZ (3)
- HP (3)
- KLK11 (3)
- MMP1 (3)
- MMP3 (3)
- MMP9 (3)
- PARK7 (3)
- SENP1 (3)
- ABHD12 (2)
- ACY1 (2)
- ADAM2 (2)
- ADAM20 (2)
- ADAM32 (2)
- ADAMTS1 (2)
- ADAMTS16 (2)
- ADAMTS6 (2)
- AGA (2)
- ATG4C (2)
- BACE1 (2)
- C1R (2)
- C1S (2)
- CAPN1 (2)
- CAPN2 (2)
- CAPNS1 (2)
- CASP10 (2)
- CASP5 (2)
- COPS5 (2)
- CTSA (2)
- CTSB (2)
- CTSE (2)
- CTSK (2)
- CTSL (2)
- CTSV (2)
- DHH (2)
- ECE1 (2)
- ENPEP (2)
- EPHX1 (2)
- ERAP1 (2)
- F12 (2)
- F2 (2)
- F7 (2)
- FURIN (2)
- GZMK (2)
- KLK3 (2)
- MALT1 (2)
- MASP2 (2)
- MBTPS2 (2)
- MMP10 (2)
- MMP12 (2)
- MMP14 (2)
- MMP15 (2)
- MMP19 (2)
- MMP23B (2)
- MYSM1 (2)
- PLAU (2)
- PLG (2)
- PRCP (2)
- PRSS50 (2)
- PSEN1 (2)
- PSMD14 (2)
- SENP3 (2)
- SENP5 (2)
- TMPRSS11E (2)
- TMPRSS3 (2)
- TPP1 (2)
- UQCRC1 (2)
- USP15 (2)
- USP45 (2)
- ABHD5 (1)
- ADAM10 (1)
- ADAM15 (1)
- ADAM21 (1)
- ADAM28 (1)
- ADAM9 (1)
- ADAMTS19 (1)
- ADAMTS5 (1)
- AEBP1 (1)
- ANPEP (1)
- APEH (1)
- ATG4A (1)
- BACE2 (1)
- BAP1 (1)
Reactivities
Applications
Antibody Hosts
Conjugates
Modifications
Pathways
- Alzheimer's disease (46)
- Apoptosis (41)
- Pathways in cancer (31)
- Lysosome (27)
- Complement and coagulation cascades (24)
- Huntington's disease (21)
- Parkinson's disease (20)
- Viral myocarditis (18)
- p53 signaling pathway (18)
- Amyotrophic lateral sclerosis (ALS) (17)
- Colorectal cancer (13)
- Renin-angiotensin system (13)
- Metabolic pathways (11)
- NOD-like receptor signaling pathway (11)
- Bladder cancer (10)
- Epithelial cell signaling in Helicobacter pylori infection (10)
- Prostate cancer (9)
- Endometrial cancer (7)
- Leukocyte transendothelial migration (7)
- Natural killer cell mediated cytotoxicity (7)
- Non-small cell lung cancer (7)
- Pancreatic cancer (7)
- RIG-I-like receptor signaling pathway (7)
- Small cell lung cancer (7)
- VEGF signaling pathway (7)
- GnRH signaling pathway (6)
- Hematopoietic cell lineage (6)
- MAPK signaling pathway (6)
- Regulation of autophagy (6)
- Neuroactive ligand-receptor interaction (5)
- Notch signaling pathway (5)
- Proteasome (5)
- Systemic lupus erythematosus (5)
- Toll-like receptor signaling pathway (5)
- Antigen processing and presentation (4)
- Cytosolic DNA-sensing pathway (4)
- Arachidonic acid metabolism (3)
- Cardiac muscle contraction (3)
- Focal adhesion (3)
- Glutathione metabolism (3)
- Hedgehog signaling pathway (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Oxidative phosphorylation (3)
- PPAR signaling pathway (3)
- Wnt signaling pathway (3)
- Arginine and proline metabolism (2)
- B cell receptor signaling pathway (2)
- Cyanoamino acid metabolism (2)
- Metabolism of xenobiotics by cytochrome P450 (2)
- Neurotrophin signaling pathway (2)
- Other glycan degradation (2)
- Regulation of actin cytoskeleton (2)
- Selenoamino acid metabolism (2)
- T cell receptor signaling pathway (2)
- Taurine and hypotaurine metabolism (2)
- Type I diabetes mellitus (2)
- Allograft rejection (1)
- Autoimmune thyroid disease (1)
- Cytokine-cytokine receptor interaction (1)
- Endocytosis (1)
- Folate biosynthesis (1)
- Glycerolipid metabolism (1)
- Graft-versus-host disease (1)
- Histidine metabolism (1)
- Melanoma (1)
- Renal cell carcinoma (1)
- Spliceosome (1)
- beta-Alanine metabolism (1)