Germany
Japan
United Kingdom
China
Antibodies
USD 380.00
2 Weeks
Rabbit monoclonal anti-ASSY antibody for SISCAPA, clone OTIR3F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SPTB1 antibody for SISCAPA, clone OTIR2D2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-SODM antibody for SISCAPA, clone OTIR4G8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit polyclonal DAPK1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This DAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1360-1389 amino acids from the C-terminal region of human DAPK1. |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-POSTN antibody for SISCAPA, clone OTIR1A5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PML antibody for SISCAPA, clone OTIR1H2
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RFA2 antibody for SISCAPA, clone OTIR2G2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TKT antibody for SISCAPA, clone OTIR4F5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PARK7 antibody for SISCAPA, clone OTIR4F10
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CD5L antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FABP4 antibody for SISCAPA, clone OTIR5E9
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-TXND5 antibody for SISCAPA, clone OTIR4D8
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PDIA3 antibody for SISCAPA, clone OTIR5G4
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CATB antibody for SISCAPA, clone OTIR1C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-OFLM4 antibody for SISCAPA, clone OTIR2A11
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-ERK3 antibody for SISCAPA, clone OTIR5F3
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal DNA Polymerase theta antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Rabbit Polyclonal Anti-CRY1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF |
Rabbit Polyclonal Anti-GADD45B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit Polyclonal Anti-NONO Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NONO antibody: synthetic peptide directed towards the C terminal of human NONO. Synthetic peptide located within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Filter by
Target Symbol
- MAPT (56)
- AKT1 (51)
- EGFR (50)
- RELA (41)
- TP53 (40)
- AMH (36)
- NPPB (28)
- ESR1 (27)
- JUN (26)
- IRS1 (25)
- ATF2 (22)
- BCL2 (22)
- CREB1 (22)
- BRCA1 (21)
- CTNNB1 (21)
- ERBB2 (21)
- APP (20)
- CDC25A (20)
- CHEK1 (20)
- EZR (20)
- SMAD3 (20)
- CASP3 (19)
- CHUK (19)
- JAK2 (19)
- KDR (19)
- NFKB1 (19)
- NR3C1 (19)
- SMAD1 (19)
- STAT1 (19)
- STAT3 (19)
- BRAF (18)
- FOXO1 (18)
- HDAC2 (18)
- NFKBIA (18)
- BAD (17)
- BAX (17)
- RAF1 (17)
- STAT6 (17)
- CASP9 (16)
- CCNB1 (16)
- CSF1R (16)
- MAPK14 (16)
- PRKCD (16)
- RPS6KB1 (16)
- SNCA (16)
- CACNB2 (15)
- CD44 (15)
- CHEK2 (15)
- GSK3B (15)
- IGF1R (15)
- IKBKB (15)
- LCK (15)
- MET (15)
- PTEN (15)
- PXN (15)
- SMAD2 (15)
- AR (14)
- BCL2L1 (14)
- CASP6 (14)
- CDH1 (14)
- CDK1 (14)
- CDKN2A (14)
- GSK3A (14)
- HDAC1 (14)
- IKBKG (14)
- MYC (14)
- NOS3 (14)
- PTPN11 (14)
- RB1 (14)
- SYK (14)
- DOK1 (13)
- ELK1 (13)
- GJA1 (13)
- HDAC5 (13)
- JUNB (13)
- KDM1A (13)
- KIT (13)
- MAPK1 (13)
- PAK1 (13)
- PDGFRB (13)
- SRC (13)
- STAT5A (13)
- STAT5B (13)
- TH (13)
- VASP (13)
- BIRC5 (12)
- CASP1 (12)
- ERBB3 (12)
- HDAC4 (12)
- HSP90AB1 (12)
- LRRK2 (12)
- MAP2K1 (12)
- MAP3K5 (12)
- MAPK8 (12)
- NBN (12)
- PRKAA1 (12)
- PTK2 (12)
- ROCK2 (12)
- RUNX1 (12)
- VCL (12)
Reactivities
- Human (18142)
- Mouse (9970)
- Rat (7730)
- Dog (579)
- Bovine (440)
- Pig (374)
- Monkey (325)
- Cow (319)
- Chicken (154)
- Rabbit (133)
- Gorilla (116)
- Rhesus Monkey (101)
- Canine (99)
- Gibbon (90)
- Xenopus (85)
- Hamster (83)
- Chimpanzee (78)
- Horse (74)
- Zebrafish (65)
- X. tropicalis (56)
- Bat (51)
- Orang-Utan (23)
- Primate (22)
- Feline (20)
- Guinea Pig (20)
- Sheep (18)
- Macaque (15)
- Porcine (13)
- Canis (11)
- Drosophila (9)
- Murine (5)
- Fish (4)
- Goat (4)
- Equine (2)
- Invertebrate (2)
- Mammalian (2)
- Saccharomyces cerevisiae (2)
- Turkey (2)
- Algal (1)
- All Species (1)
- C. elegans (1)
- Escherichia coli (1)
- Ferret (1)
- Frog (1)
- Insect (1)
- Medaka fish (1)
- Opossum (1)
- Quail (1)
- Tobacco hornworm (1)
- Yeast (1)
Applications
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (2048)
- Metabolic pathways (1378)
- MAPK signaling pathway (1319)
- Cytokine-cytokine receptor interaction (1061)
- Focal adhesion (1034)
- Chemokine signaling pathway (899)
- Prostate cancer (868)
- Neurotrophin signaling pathway (861)
- Neuroactive ligand-receptor interaction (822)
- Regulation of actin cytoskeleton (755)
- Colorectal cancer (739)
- Pancreatic cancer (724)
- Chronic myeloid leukemia (708)
- T cell receptor signaling pathway (695)
- Cell cycle (694)
- ErbB signaling pathway (676)
- Jak-STAT signaling pathway (668)
- Apoptosis (652)
- Toll-like receptor signaling pathway (634)
- Insulin signaling pathway (631)
- Small cell lung cancer (615)
- Wnt signaling pathway (599)
- Calcium signaling pathway (593)
- Melanoma (549)
- Acute myeloid leukemia (528)
- Glioma (527)
- Progesterone-mediated oocyte maturation (524)
- Endometrial cancer (515)
- B cell receptor signaling pathway (511)
- Adipocytokine signaling pathway (510)
- Natural killer cell mediated cytotoxicity (500)
- Endocytosis (499)
- Non-small cell lung cancer (497)
- Leukocyte transendothelial migration (471)
- Alzheimer's disease (470)
- Adherens junction (467)
- p53 signaling pathway (445)
- Renal cell carcinoma (442)
- GnRH signaling pathway (430)
- Epithelial cell signaling in Helicobacter pylori infection (429)
- Fc gamma R-mediated phagocytosis (425)
- VEGF signaling pathway (425)
- TGF-beta signaling pathway (421)
- Fc epsilon RI signaling pathway (419)
- Axon guidance (418)
- Oocyte meiosis (411)
- Bladder cancer (410)
- Gap junction (402)
- Melanogenesis (396)
- NOD-like receptor signaling pathway (394)
- Amyotrophic lateral sclerosis (ALS) (376)
- Huntington's disease (365)
- Tight junction (347)
- Vascular smooth muscle contraction (341)
- RIG-I-like receptor signaling pathway (320)
- Hematopoietic cell lineage (319)
- Ubiquitin mediated proteolysis (293)
- Long-term potentiation (289)
- Long-term depression (283)
- mTOR signaling pathway (274)
- Cell adhesion molecules (CAMs) (262)
- Type II diabetes mellitus (254)
- Dilated cardiomyopathy (251)
- Hypertrophic cardiomyopathy (HCM) (244)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (242)
- Thyroid cancer (239)
- Pathogenic Escherichia coli infection (223)
- Basal cell carcinoma (217)
- Complement and coagulation cascades (213)
- Cytosolic DNA-sensing pathway (210)
- ECM-receptor interaction (199)
- Purine metabolism (190)
- PPAR signaling pathway (183)
- Parkinson's disease (183)
- Viral myocarditis (175)
- Glycolysis / Gluconeogenesis (174)
- Phosphatidylinositol signaling system (157)
- Prion diseases (156)
- Notch signaling pathway (150)
- Olfactory transduction (150)
- Lysosome (143)
- Drug metabolism - cytochrome P450 (141)
- Metabolism of xenobiotics by cytochrome P450 (141)
- Primary immunodeficiency (140)
- Dorso-ventral axis formation (133)
- Nucleotide excision repair (130)
- Hedgehog signaling pathway (127)
- Arginine and proline metabolism (123)
- Antigen processing and presentation (122)
- ABC transporters (118)
- Retinol metabolism (115)
- Vibrio cholerae infection (113)
- Base excision repair (112)
- Systemic lupus erythematosus (108)
- Type I diabetes mellitus (108)
- Arachidonic acid metabolism (106)
- Inositol phosphate metabolism (105)
- Tyrosine metabolism (102)
- Valine (100)
- Homologous recombination (99)
- Pyruvate metabolism (95)
- Allograft rejection (93)
- Fatty acid metabolism (90)
- Autoimmune thyroid disease (89)
- Cardiac muscle contraction (88)
- Tryptophan metabolism (88)
- Pyrimidine metabolism (86)
- leucine and isoleucine degradation (86)
- Glycerolipid metabolism (84)
- Butanoate metabolism (82)
- Fructose and mannose metabolism (82)
- Drug metabolism - other enzymes (79)
- Alanine (74)
- aspartate and glutamate metabolism (74)
- Mismatch repair (73)
- Maturity onset diabetes of the young (72)
- Taste transduction (72)
- Graft-versus-host disease (70)
- Glutathione metabolism (69)
- Regulation of autophagy (69)
- Lysine degradation (67)
- Proteasome (67)
- DNA replication (66)
- Histidine metabolism (63)
- Galactose metabolism (62)
- Non-homologous end-joining (62)
- Renin-angiotensin system (62)
- Asthma (60)
- Cysteine and methionine metabolism (60)
- Propanoate metabolism (60)
- Glycerophospholipid metabolism (59)
- Starch and sucrose metabolism (59)
- Androgen and estrogen metabolism (56)
- Citrate cycle (TCA cycle) (55)
- Linoleic acid metabolism (52)
- Sphingolipid metabolism (52)
- Nitrogen metabolism (50)
- Pentose phosphate pathway (50)
- Porphyrin and chlorophyll metabolism (49)
- Amino sugar and nucleotide sugar metabolism (48)
- beta-Alanine metabolism (48)
- Phenylalanine metabolism (43)
- SNARE interactions in vesicular transport (43)
- Oxidative phosphorylation (40)
- Glycine (36)
- serine and threonine metabolism (36)
- Basal transcription factors (34)
- C21-Steroid hormone metabolism (32)
- Spliceosome (32)
- Primary bile acid biosynthesis (30)
- Aminoacyl-tRNA biosynthesis (29)
- Circadian rhythm - mammal (28)
- Folate biosynthesis (27)
- Glycosaminoglycan degradation (27)
- Riboflavin metabolism (27)
- Nicotinate and nicotinamide metabolism (26)
- Ascorbate and aldarate metabolism (25)
- Ether lipid metabolism (25)
- Pentose and glucuronate interconversions (25)
- RNA degradation (23)
- Selenoamino acid metabolism (23)
- Terpenoid backbone biosynthesis (23)
- Limonene and pinene degradation (21)
- Ribosome (21)
- Synthesis and degradation of ketone bodies (21)
- Glyoxylate and dicarboxylate metabolism (20)
- Pantothenate and CoA biosynthesis (19)
- leucine and isoleucine biosynthesis (18)
- Methane metabolism (16)
- One carbon pool by folate (16)
- Other glycan degradation (16)
- Taurine and hypotaurine metabolism (16)
- Caffeine metabolism (15)
- Steroid biosynthesis (15)
- N-Glycan biosynthesis (14)
- Fatty acid biosynthesis (12)
- alpha-Linolenic acid metabolism (12)
- Glycosphingolipid biosynthesis - globo series (11)
- Biosynthesis of unsaturated fatty acids (8)
- Glycosphingolipid biosynthesis - ganglio series (7)
- Vitamin B6 metabolism (7)
- Heparan sulfate biosynthesis (6)
- Fatty acid elongation in mitochondria (5)
- O-Glycan biosynthesis (5)
- Phenylalanine (5)
- tyrosine and tryptophan biosynthesis (5)
- RNA polymerase (4)
- Thiamine metabolism (4)
- Ubiquinone and other terpenoid-quinone biosynthesis (4)
- D-Glutamine and D-glutamate metabolism (3)
- Glycosphingolipid biosynthesis - lacto and neolacto series (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (3)
- Sulfur metabolism (3)
- Lysine biosynthesis (2)
- Protein export (2)
- Chondroitin sulfate biosynthesis (1)
- D-Arginine and D-ornithine metabolism (1)
- Keratan sulfate biosynthesis (1)