Rabbit Polyclonal Anti-PARD6A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARD6A |
Rabbit Polyclonal Anti-PARD6A Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PARD6A |
Rabbit polyclonal MDM2 (Ab-166) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T). |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Polyclonal Antibody against MDM2 (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Goat Polyclonal Antibody against VPS25
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1. |
Rabbit polyclonal anti-TSG101 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TS101. |
Anti-PARD6A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
PARD6A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human paxillin |
Rabbit Polyclonal Cbl Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Cbl antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human cbl. |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
Modifications | Phospho-specific |
Rabbit Polyclonal CBL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 around the phosphorylation site of Serine 166 |
Modifications | Phospho-specific |
Rabbit polyclonal ITCH (Ab-420) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
Modifications | Phospho-specific |
Rabbit Polyclonal ITCH Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ITCH antibody was raised against a 15 amino acid peptide near the amino terminus of human ITCH |
Goat Polyclonal Antibody against ITCH / AIF4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EIKSHDLKPNGGN, from the internal region of the protein sequence according to NP_113671.3. |
Rabbit polyclonal anti-ZFYVE20 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZFYVE20. |
Rabbit Polyclonal MDM2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2. |
Rabbit Polyclonal anti-PARD6A antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PARD6A antibody: synthetic peptide directed towards the N terminal of human PARD6A. Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-PARD6A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans) |
Rabbit Polyclonal Anti-VPS25 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-SMURF2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMURF2 |
Rabbit Polyclonal Anti-CBL Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CBL |
Rabbit Polyclonal Anti-DNM2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DNM2 |
Rabbit Polyclonal Anti-VPS4B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS4B |
Rabbit Polyclonal Anti-VPS36 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human VPS36 |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI3E4 (formerly 3E4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CBL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBL |
Rabbit Polyclonal anti-CBL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CBL |