Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rat Anti-Human CD197 (CCR7) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti-IL7R Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL7R |
USD 380.00
In Stock
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal antibody to Activin A Receptor type IIA (activin A receptor, type IIA)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 267 and 513 of Activin A Receptor type IIA (Uniprot ID#P27037) |
Rabbit Polyclonal Anti-TGFR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TGFR2 Antibody: A synthesized peptide derived from human TGFR2 |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
USD 515.00
In Stock
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
IFNAR2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR2 |
Rabbit Polyclonal Anti-TNFSF14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF14 antibody: synthetic peptide directed towards the middle region of human TNFSF14. Synthetic peptide located within the following region: ATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFM |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (122)
- CD40 (76)
- TNFRSF8 (57)
- KIT (55)
- CD27 (48)
- TNFRSF9 (43)
- MET (42)
- TNF (39)
- PDGFRA (36)
- NGFR (34)
- KDR (33)
- PDGFRB (29)
- IL10RA (27)
- TNFRSF18 (26)
- CSF2RB (23)
- TNFRSF14 (23)
- TNFRSF4 (23)
- CD70 (22)
- TNFRSF10B (22)
- TNFSF10 (22)
- HGF (21)
- CSF1 (20)
- EGF (20)
- CSF1R (19)
- CSF2RA (18)
- IL25 (18)
- KITLG (18)
- CXCR4 (17)
- IFNLR1 (17)
- IL2RB (17)
- IL3RA (17)
- CXCL8 (16)
- FLT4 (16)
- IL2RA (15)
- TGFBR2 (15)
- IL20RA (14)
- TNFRSF10A (14)
- EPOR (13)
- ACVR2A (12)
- IL12B (12)
- TNFSF11 (12)
- TNFSF9 (12)
- CCL5 (10)
- IL23R (10)
- TNFSF13B (10)
- TNFSF4 (10)
- CCR5 (9)
- CCR7 (9)
- FLT3 (9)
- TNFRSF17 (9)
- TNFSF13 (9)
- CCL11 (8)
- CX3CR1 (8)
- CXCR2 (8)
- CXCR3 (8)
- EPO (8)
- FASLG (8)
- IFNGR2 (8)
- TGFB2 (8)
- TNFRSF1A (8)
- ACVR1 (7)
- CX3CL1 (7)
- EDA (7)
- IFNL1 (7)
- IL12RB1 (7)
- IL13 (7)
- IL17RA (7)
- IL1R2 (7)
- IL6R (7)
- TGFBR1 (7)
- TNFRSF1B (7)
- TNFSF14 (7)
- BMPR2 (6)
- CCR8 (6)
- CRLF2 (6)
- IL11RA (6)
- IL18R1 (6)
- IL22RA1 (6)
- LTBR (6)
- TNFRSF11A (6)
- TNFRSF25 (6)
- TPO (6)
- ACVR1B (5)
- ACVRL1 (5)
- CCR1 (5)
- CD40LG (5)
- CXCL14 (5)
- CXCR6 (5)
- FLT3LG (5)
- IFNB1 (5)
- TNFRSF12A (5)
- TNFRSF13B (5)
- TNFRSF21 (5)
- TNFSF15 (5)
- ACVR2B (4)
- BMP2 (4)
- CCR3 (4)
- CCR4 (4)
- CSF3R (4)
- CXCR1 (4)