Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the C terminal of human PSMA1. Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit anti-PSMA1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMA1 |
Rabbit anti-PSMB4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSMB4 |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE |
Rabbit Polyclonal Anti-PSMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA1 antibody: synthetic peptide directed towards the N terminal of human PSMA1. Synthetic peptide located within the following region: MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALK |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 205 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
Rabbit polyclonal antibody to 20S Proteasome alpha3 (proteasome (prosome, macropain) subunit, alpha type, 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 137 of Proteasome 20S alpha 3 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 6 (Uniprot ID#P60900) |
Rabbit Polyclonal antibody to Proteasome 20S alpha 7 (proteasome (prosome, macropain) subunit, alpha type, 7)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 10 and 247 of Proteasome 20S alpha 7 (Uniprot ID#O14818) |
Rabbit Polyclonal Anti-PSMD7 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Psmd7 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psmd7. Synthetic peptide located within the following region: LIRSVVALHNLINNKIANRDAEKKEGQEKEESKKERKDDKEKEKSDAKKE |
PSMD7 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human PSMD7 |
PSMA7 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PSMA7 |
PSMB9 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PSMB9 |
PSMB10 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 213-242 amino acids from the C-terminal region of Human PSMB10 |
Goat Anti-LMP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DVSDLLHQYREANQ, from the C-Terminus of the protein sequence according to NP_004150.1; NP_683720.2. |
Goat Anti-PSMB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2. |
Anti-PSMB9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-PSMA6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal anti-PSMB2 antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PSMB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 133-163 amino acids from the C-terminal region of human PSMB2. |
Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14. Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
Rabbit Polyclonal Anti-PSMA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMA4 Antibody: synthetic peptide directed towards the N terminal of human PSMA4. Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN |
Rabbit Polyclonal Anti-PSMB8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMB8 antibody is: synthetic peptide directed towards the N-terminal region of Human PSMB8. Synthetic peptide located within the following region: MLIGTPTPRDTTPSSWLTSSLLVEAAPLDDTTLPTPVSSGCPGLEPTEFF |
Rabbit polyclonal Anti-PSMA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2. Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
Rabbit polyclonal Anti-PSMA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the N terminal of human PSMA5. Synthetic peptide located within the following region: MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAV |
Rabbit polyclonal Anti-PSMA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA5 antibody: synthetic peptide directed towards the middle region of human PSMA5. Synthetic peptide located within the following region: FGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLK |
Rabbit polyclonal Anti-PSMB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB1 antibody: synthetic peptide directed towards the middle region of human PSMB1. Synthetic peptide located within the following region: NNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVG |
Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA |
Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD |
Rabbit polyclonal Anti-PSMB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ |
Rabbit polyclonal Anti-PSMB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5. Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ |
