Mouse Monoclonal ApoE4 Antibody (4E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal ApoE4 Antibody (4E4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584] |
TNF-A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone MAb1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700026 |
Mouse Anti-Human IL-1 beta Purified (50 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-TNF-R1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNF-R1 |
Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
Goat Polyclonal Antibody against APOE
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1. |
Rabbit polyclonal anti-TNFA antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNFA. |
Rabbit polyclonal APOE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Biotinylated Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human sTNF Receptor Type I |
TNFRSF1A Capture mouse monoclonal antibody, ELISA and Luminex validated, clone TBP
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700021 |
Rabbit polyclonal anti-E2AK3 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human E2AK3. |
Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
Rabbit polyclonal anti-FAS antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Fas. |
Rabbit Polyclonal APO-E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APO-E antibody was raised against a 19 amino acid peptide near the carboxy terminus of human APO-E. |
FAS Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FAS |
Rabbit anti-IL1B Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL1B |
Mouse Monoclonal Apolipoprotein E/ApoE Antibody (1H4)
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PERK Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PERK Antibody: A synthesized peptide derived from human PERK |
Rabbit Polyclonal Fas Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Mouse Monoclonal Anti-TNF Antibody, Biotinylated
Applications | E |
Reactivities | Human, Monkey |
Conjugation | Biotin |
Rabbit Polyclonal Antibody against APOE (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APOE antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 263-292 amino acids from the C-terminal region of human APOE. |
Rabbit polyclonal TNF Receptor-1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1. |
Rabbit polyclonal PEK/PERK (Ab-981) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal TNFA Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human TNFA |
Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Mouse Monoclonal Apolipoprotein E/ApoE Antibody (WUE-4)
Applications | FC, WB |
Reactivities | Human, Mouse (Does not react with: Rat) |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal TNF Alpha antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Rabbit polyclonal TNF alpha antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli. |
Anti-Human ApoE3 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human ApoE3 |
Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit Polyclonal Anti-TNFRSF1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI |
Rabbit Polyclonal TNF-alpha Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
IL1 beta (IL1B) mouse monoclonal antibody, clone S1B7, Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL1 beta (IL1B) mouse monoclonal antibody, clone S3F12, Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-FAS / CD95 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Goat Anti-TNFRSF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SDHEIDRLELQNGR, from the internal region of the protein sequence according to NP_001056.1. |
Rabbit polyclonal anti-ApoE4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant human ApoE4 |
Rabbit polyclonal IL-1 beta antibody
Applications | WB |
Reactivities | Human, Primate, Dog |
Conjugation | Unconjugated |
Immunogen | This antibody was prepared by repeated immunizations with recombinant human IL-1β produced in E.coli. The MW of the recombinant 153 aa IL-1β was 17 kDa with the N-terminal amino acid at position alanine 117. This cleavage site is generated by the IL-1β converting enzyme (ICE, capase-1). |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TNF-R1 Antibody
Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Biotinylated Anti-Human ApoE3 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human ApoE3 |
Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |