Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal VMAT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human VMAT2 protein (within residues 30-200). [Swiss-Prot Q05940] |
Rabbit Polyclonal Anti-TRPC1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide QLYDKGYTSKEQKDC, corresponding to amino acid residues 557-571 of human TRPC1.Intracellular. |
USD 424.00
2 Weeks
Mouse Monoclonal SLC6A3/DAT1 Antibody (mAb16)
Applications | IHC, WB |
Reactivities | Mouse, Rat (Does not react with: Human) |
Conjugation | Unconjugated |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit anti-SLC25A4 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SLC25A4 |
Rabbit anti-HTRA2 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HTRA2 |
Rabbit polyclonal anti-COX6C antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX6C. |
Rabbit polyclonal anti-ATP5G3 antibody
Applications | IF, IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G3. |
Rabbit polyclonal anti-GPR37 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR37. |
Rabbit polyclonal anti-NDUFA4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4. |
Rabbit polyclonal anti-COX42 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX42. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Rabbit Polyclonal Anti-COX42 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX42 Antibody: A synthesized peptide derived from human COX42 |
Rabbit Polyclonal Anti-COX6C Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX6C Antibody: A synthesized peptide derived from human COX6C |
Rabbit Polyclonal Anti-COX IV antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX IV antibody: A synthesized peptide derived from human COX IV |
Rabbit Polyclonal Anti-SLC25A4 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT |
Goat Anti-COX4I2 & COX4I1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RWDYEKKQWKK, from the C Terminus of the protein sequence according to NP_115998.2. |
Rabbit polyclonal anti-NDUC2 antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUC2. |
Rabbit polyclonal anti-HtrA2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human HtrA2. |
Rabbit polyclonal Ubiquitin-Conjugating Enzyme E2 J2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of the human Ube2j2 protein. |
Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLC18A2 mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3E6 (formerly 3E6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI3D1 (formerly 3D1)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody,clone OTI3D5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI1C7 (formerly 1C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) UBE2J1 mouse monoclonal antibody, clone OTI2G2 (formerly 2G2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI5C10
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI2E7
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI3C7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDUFA4L2 mouse monoclonal antibody,clone OTI4F4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC25A4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 40-52 amino acids of human solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |
Anti-SLC18A2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2 |
Anti-COX8A Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-SLC18A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 104-117 amino acids of human solute carrier family 18 (vesicular monoamine), member 1 |
Rabbit Polyclonal Anti-NDUFA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NDUFA1 |
Rabbit Polyclonal Anti-SLC6A3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC6A3 |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI10C11 (formerly 10C11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-SLC18A2 (VMAT2) mouse monoclonal antibody, clone OTI9E11 (formerly 9E11)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |