Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-DLD Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF |
Anti-ADH5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit polyclonal anti-HK1 (HXK1) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HXK1. |
PCK1 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PCK1 |
Rabbit anti-PGK1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGK1 |
Rabbit anti-PFKM Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PFKM |
Rabbit Polyclonal Anti-Hexokinase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Hexokinase 1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human Hexokinase 1. |
Rabbit Polyclonal Antibody against ALDH2 (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2. |
Rabbit polyclonal ENO1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1. |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit Polyclonal Antibody against ALDH2 (N-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2. |
Rabbit polyclonal anti-ALDOB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDOB. |
Rabbit polyclonal anti-K6PP / PFKP antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human K6PP. |
Rabbit polyclonal anti-K6PL antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human K6PL. |
Rabbit polyclonal anti-ALDOA antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ALDOA. |
Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2). |
Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA). |
Rabbit polyclonal AKR1A1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human AKR1A1. |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 293 of the human Pyruvate Dehydrogenase E1-alpha subunit protein. [Swiss-Prot #P08559] |
Goat Polyclonal Antibody against ADH1A, B, C
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence STAGKVMKCKA, from the N Terminus of the protein sequence according to NP_000658.1; NP_000659.2; NP_000660.1. |
Goat Anti-PCK1 / PEPCKC (internal) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3. |
Goat Anti-ADH5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKIKVDEFVTHN, from the internal region of the protein sequence according to NP_000662.3 . |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Rabbit anti-AKR1A1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Active filters
Reactivities
- Rat
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Glycolysis / Gluconeogenesis
Filter by
Category
Target Symbol
- ALDOA (7)
- AKR1A1 (6)
- PKM (6)
- PCK1 (5)
- ALDH2 (4)
- ALDH3A1 (4)
- ALDH9A1 (4)
- ALDOB (4)
- ENO1 (4)
- HK1 (4)
- PDHA1 (4)
- ADH1A (3)
- ADH1B (3)
- ADH5 (3)
- ALDH3B1 (3)
- GCK (3)
- HK2 (3)
- PFKL (3)
- ADH4 (2)
- DLD (2)
- LDHB (2)
- PFKM (2)
- PFKP (2)
- PGK1 (2)
- ALDH1B1 (1)
- BPGM (1)
- DLAT (1)
- FBP1 (1)
- FBP2 (1)
- HK3 (1)
- LDHA (1)
- PGAM2 (1)
- PGK2 (1)