Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-ADH5 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ADH5 |
Rabbit anti-UGT1A1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A1 |
Rabbit Polyclonal Anti-CYP1B1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Cyp1b1 antibody is: synthetic peptide directed towards the middle region of human CYP1B1 |
AKR1C3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AKR1C3 |
Rabbit anti-CYP2E1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP2E1 |
Rabbit anti-GSTP1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTP1 |
Anti-ADH5 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-CYP2C19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C19 antibody: synthetic peptide directed towards the middle region of human CYP2C19. Synthetic peptide located within the following region: QEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCD |
Rabbit anti-ALDH3A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ALDH3A1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-ADH1B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
Rabbit Polyclonal Anti-Cytochrome P450 2C19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2C19 Antibody: A synthesized peptide derived from human Cytochrome P450 2C19 |
Rabbit Polyclonal antibody to GSTM1 (glutathione S-transferase mu 1)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 189 of GSTM1 |
Rabbit Polyclonal Anti-CYP1A1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit Polyclonal Anti-GSTP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GSTP1 antibody is: synthetic peptide directed towards the N-terminal region of Human GSTP1. Synthetic peptide located within the following region: TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ |
Rabbit Polyclonal GSTP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1. |
Rabbit Polyclonal Anti-ADH1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA |
Rabbit Polyclonal Anti-CYP2C9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C9 antibody: synthetic peptide directed towards the C terminal of human CYP2C9. Synthetic peptide located within the following region: AGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVPPFYQLCFIPV |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
Rabbit polyclonal CYP1A2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
Rabbit anti-EPHX1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human EPHX1 |
Rabbit anti-CYP1A1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYP1A1 |
Rabbit Polyclonal Anti-ADH1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA |
Rabbit Polyclonal Anti-Adh7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Adh7 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Adh7. Synthetic peptide located within the following region: LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTL |
Rabbit polyclonal antibody to GSTA1 (glutathione S-transferase A1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-ALDH3B1 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALDH3B1. |
Rabbit polyclonal CYP2B6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit polyclonal CYP2S1 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CYP2S1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-428 amino acids from the C-terminal region of human CYP2S1. |
Rabbit polyclonal ADH1B Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit polyclonal ADH7 Antibody (C-Term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7. |
GSTA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTA1 |
Rabbit Polyclonal Anti-GSTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the N terminal of human GSTM1. Synthetic peptide located within the following region: KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI |
Rabbit Polyclonal Anti-GSTM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTM1 antibody: synthetic peptide directed towards the C terminal of human GSTM1. Synthetic peptide located within the following region: PEKLKLYSEFLGKRPWFAGNKGLEKISAYMKSSRFLPRPVFSKMAVWGNK |
Rabbit Polyclonal Anti-ADH1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD |
Rabbit Polyclonal Anti-ADH6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI |
Rabbit Polyclonal Anti-CYP3A7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP3A7 antibody: synthetic peptide directed towards the middle region of human CYP3A7. Synthetic peptide located within the following region: KLALVRVLQNFSFKPCKETQIPLKLRFGGLLLTEKPIVLKAESRDETVSG |
Rabbit Polyclonal Anti-CYP2B6 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2B6 antibody: synthetic peptide directed towards the middle region of human CYP2B6. Synthetic peptide located within the following region: QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL |
Rabbit Polyclonal Anti-CYP2C18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2C18 antibody: synthetic peptide directed towards the N terminal of human CYP2C18. Synthetic peptide located within the following region: MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM |
Rabbit Polyclonal Anti-Cytochrome P450 2B6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 2B6 Antibody: A synthesized peptide derived from human Cytochrome P450 2B6 |
Rabbit Polyclonal Anti-Cytochrome P450 1A1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cytochrome P450 1A1/2 Antibody: A synthesized peptide derived from human Cytochrome P450 1A1/2 |
Rabbit Polyclonal CYP1B1 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
Applications | ELISA, R, WB |
Reactivities | Human |
Immunogen | Human Glutathion S-Transferase pi |
GST3 (GSTP1) rabbit polyclonal antibody, Serum
Applications | ELISA, R, WB |
Reactivities | Human |
Immunogen | Human Glutathion S-Transferase pi |
USD 370.00
2 Weeks
Cytochrome P450 2C8 (CYP2C8) (+ 2C9, 2C18, 2C19) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 100-150 of Human CYP2C8. |
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
Cytochrome p450 2C19 (CYP2C19) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 257-285 amino acids from the Central region of Human CYP2C19. |