Antibodies

View as table Download

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CASP3

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP3

Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IGF-I

Rabbit anti-IGF1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IGF1

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS

Rabbit Polyclonal Anti-IGF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Caspase 3 (CASP3) (p17) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Goat Anti-IGF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RSVRAQRHTD, from the internal region of the protein sequence according to NP_001104753.1; NP_001104754.1; NP_001104755.1; NP_000609.1.

Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Caspase 3.

Rabbit polyclonal CASP3 (p17, Cleaved-Asp175) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

Rabbit polyclonal Caspase 3 (Cleaved-Ser29) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CASP3.

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase

Rabbit polyclonal CASP3 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3.

Rabbit polyclonal CASP3(Asp175) Antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP3(Asp175) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-179 amino acids from human CASP3(Asp175).

Rabbit Polyclonal Caspase 3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 3

Rabbit Polyclonal Caspase 3 (Ser150) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 3 around the phosphorylation site of Serine 150
Modifications Phospho-specific

Rabbit Polyclonal active/cleaved Caspase 3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human caspase-3 protein was used as immunogen.

Rabbit anti IGF-I Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.

Caspase 3 (CASP3) (full length) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Yeast
Immunogen Recombinant human Caspase-3 protein (full length)

IGF1 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived recombinant Human IGF-I (Cat.-No PA071)

IGF1 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen E.coli derived recombinant Human IGF-I (Cat.-No PA071)

Rabbit polyclonal anti-OR7E5P antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR7E5P.

Rabbit Polyclonal Cleaved-caspase 3 antibody

Applications WB
Reactivities Human Mouse Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen conjugated synthetic peptide selected from the Center region of human FAS

Caspase 3 (CASP3) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human Caspase-3 (P10)

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.323~327 derived from human Fas .

Caspase 3 (CASP3) (29-33) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.29~33 derived from Caspase 3

Caspase 3 (CASP3) (29-33) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Peptide sequence around aa.29~33 derived from Caspase 3

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.

Goat Anti-Caspase 3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDVSKEDHSKRS, from the internal region of the protein sequence according to NP_004337.2; NP_116786.1.

Rabbit polyclonal anti-IGF-I antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli expressed human IGF-I

Rabbit polyclonal anti-IGF-I antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant murine IGF-I

Rabbit polyclonal anti-Anti-Rat IGF-1 antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant rat IGF-1

Rabbit Polyclonal Caspase-3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-3 antibody was raised against a 17 amino acid synthetic peptide near the center of human Caspase-3.

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD

Rabbit anti CD95 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Anti-CASP3 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)

Rabbit Polyclonal Anti-IGF1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IGF1