Phosphodiesterase 6a / PDE6A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PDE6A antibody was raised against synthetic 18 amino acid peptide from N-terminus of human PDE6A / PDE6 Alpha. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Dog, Panda, Rabbit (94%); Bovine, Bat, Elephant (89%); Horse, Opossum (83%). |
PDE8A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | PDE8A antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human PDE8A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Dog, Panda, Horse, Rabbit, Pig (100%); Marmoset (94%); Mouse, Rat, Bovine, Elephant, Opossum (88%); Platypus, Zebrafish (81%). |
PTPRM Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
ASCT1 / SLC1A4 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | SLC1A4 / ASCT1 antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human SLC1A4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey, Mouse, Rat, Dog, Rabbit, Horse (93%); Elephant, Panda (86%). |
SLC4A2 / AE2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Hamster, Horse, Human, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC4A2 / AE2 antibody was raised against synthetic 18 amino acid peptide from N-Terminus of human SLC4A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Orangutan, Gibbon, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Dog, Horse, Rabbit, Pig (100%); Monkey, Bovine, Guinea pig (94%); Elephant (89%); Bat, Opossum (83%). |
SLC7A2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | SLC7A2 antibody was raised against synthetic 12 amino acid peptide from internal region of human SLC7A2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Mouse, Rat, Rabbit, Pig (100%); Orangutan, Gibbon, Galago, Marmoset, Hamster, Bovine, Bat, Horse (92%); Panda, Dog, Platypus (83%). |
T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit |
TM9SF4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | TM9SF4 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Panda (87%); Opossum (80%). |
TNIK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Chicken, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNIK antibody was raised against synthetic 18 amino acid peptide from internal region of human TNIK. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Opossum, Chicken, Lizard (100%); Xenopus (94%). |
TRPV4 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
TSPAN13 / TM4SF13 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TSPAN13 / TM4SF13 antibody was raised against synthetic 13 amino acid peptide from internal region of human TSPAN13. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Elephant, Panda, Horse, Rabbit (100%); Bat, Bovine, Hamster, Opossum, Platypus (92%). |
TSPAN13 / TM4SF13 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TSPAN13 / TM4SF13 antibody was raised against synthetic 13 amino acid peptide from internal region of human TSPAN13. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Horse (100%); Orangutan, Elephant, Panda, Dog, Rabbit, Opossum, Platypus (92%); Bat, Bovine, Pig, Guinea pig, Pufferfish, Zebrafish (85%). |
USP2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | USP2 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum (100%); Pig (94%). |
WNT6 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |
WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%). |
WNT14 / WNT9A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT14 / WNT9A antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human WNT9A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Mouse, Rat, Bovine, Bat, Rabbit (94%). |
GPR3 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Hamster, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GPR3 antibody was raised against synthetic 15 amino acid peptide from 2nd extracellular domain of human GPR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster (100%); Rabbit (93%); Bovine, Panda, Pig (80%). |
AVPR1B Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | AVPR1B antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human AVPR1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Bovine, Dog, Bat, Elephant, Panda, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Mouse (94%). |
MGLUR2 / GLUR2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRM2 / MGLUR2 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human GRM2 / MGLUR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Rabbit, Pig (100%); Chimpanzee, Monkey, Horse, Platypus (95%). |
GPR4 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | GPR4 antibody was raised against synthetic 20 amino acid peptide from 3rd cytoplasmic domain of human GPR4. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Dog, Panda, Pig (100%); Bovine, Bat, Rabbit, Zebrafish (95%); Mouse, Rat (85%). |
GPR120 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | O3FAR1 / GPR120 antibody was raised against synthetic 18 amino acid peptide from 3rd cytoplasmic domain of human O3FAR1 / GPR120. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bat, Elephant, Rabbit (94%); Marmoset, Mouse, Rat, Pig (89%); Bovine, Dog, Hamster, Horse (83%). |
GPRC6A Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPRC6A antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human GPRC6A. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Rat, Hamster, Rabbit (93%); Monkey, Marmoset, Mouse, Dog, Elephant, Panda, Horse (86%). |
CCKAR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | CCKAR / CCK1R antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CCKAR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Bovine, Rabbit, Guinea pig (94%); Mouse, Elephant, Panda, Bat (88%); Rat, Dog, Horse, Opossum (81%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 14 amino acid peptide from 2nd extracellular domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Rabbit, Pig, Platypus (100%); Marmoset, Rat, Elephant, Panda, Dog, Bat, Horse (93%); Mouse, Hamster (86%). |
Orexin Receptor 1 / OX1R Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | OX1R / Orexin Receptor 1 antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human HCRTR1 / Orexin Receptor 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Dog, Rabbit, Pig (93%); Mouse, Rat, Hamster, Elephant, Panda, Bovine, Bat (87%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Dog, Bovine (100%); Mouse, Rat, Hamster, Bat, Rabbit (94%); Opossum (81%). |
WNT9B Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | WNT9B / WNT15 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT9B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig (100%); Bat, Rabbit (94%); Dog (88%). |
WNT10A Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Human, Monkey, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | WNT10A antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT10A. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Bovine, Bat, Elephant, Panda, Rabbit (100%); Rat, Hamster, Opossum (94%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
WNT11 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | WNT11 antibody was raised against synthetic 15 amino acid peptide from internal region of human WNT11. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Rabbit, Pig, Turkey, Chicken, Platypus (100%); Opossum, Stickleback (87%); Xenopus, Zebrafish (80%). |
Rabbit polyclonal anti-Calpain 1 antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Anti-PTH1R Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 130 amino acids of human parathyroid hormone 1 receptor |
Anti-PMS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human PMS1 postmeiotic segregation increased 1 (S. cerevisiae) |
Rabbit polyclonal TXN Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TXN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-94 amino acids from the C-terminal region of human TXN. |
Rabbit polyclonal PITPNA Antibody (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PITPNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-270 amino acids from the C-terminal region of human PITPNA. |
Rabbit polyclonal PTGER4 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PTGER4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human PTGER4. |
Rabbit polyclonal PPP2R2A Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPP2R2A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-71 amino acids from the N-terminal region of human PPP2R2A. |
Rabbit polyclonal Hsp60 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Hsp60 produced through recombinant DNA methods in E.coli |
Rabbit polyclonal SOD (Mn) Antibody
| Applications | IHC |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Gerbil, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig |
| Conjugation | Unconjugated |
| Immunogen | Human Mn SOD |
Rabbit polyclonal Akt2 (PKB beta) Antibody
| Applications | WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | A five residue synthetic peptide based on the human Akt2, coupled to KLH |
Rabbit Polyclonal Anti-Calnexin -CT Antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Bovine, Chicken (weak), Dog, Guinea pig, Hamster, Pig, Quail, Rabbit, Sheep, Drosophila (weak), Xenopus (weak) |
| Conjugation | Unconjugated |
| Immunogen | Dog Calnexin C-terminal synthetic peptide conjugated to KLH. Identical to human, mouse and rat calnexin sequences over these residues. |
Rabbit Polyclonal Anti-Calcineurin A Antibody
| Reactivities | Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Human Calcineurin A peptide (AA 364-283) |
Rabbit Polyclonal Anti-TNF-R1 Antibody
| Reactivities | Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues |
Rabbit polyclonal anti-PLN antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLN antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 1-22 amino acids from the N-terminal region of human PLN. |
Rabbit polyclonal anti-BLMH antibody (Center)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This BLMH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 212-242 amino acids from the Central region of human BLMH. |
Rabbit polyclonal anti-R Csnk2a1 antibody (N-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This Rat Csnk2a1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-50 amino acids from the N-terminal region of Rat Csnk2a1. |
Rabbit Polyclonal Anti-SIAH3 Antibody
| Applications | WB |
| Reactivities | Human, Rabbit, Dog, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIAH3 antibody is: synthetic peptide directed towards the N-terminal region of Human SIAH3. Synthetic peptide located within the following region: YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA |
Rabbit Polyclonal Tmp21/p23 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Primate, Rabbit, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal sequence of the human TMP21 protein (within residues 50-150). [Swiss-Prot# P49755] |
Germany
Japan
United Kingdom
China
