Antibodies

View as table Download

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit anti-CDK4 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK4

Rabbit Polyclonal CDKN2A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A.

Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7)

Rabbit anti-CYCS Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYCS

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CASP3

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP3

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1.

Rabbit Polyclonal Anti-KIRREL2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2.

Rabbit Polyclonal p53AIP1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen p53AIP1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human p53AIP1.

Rabbit anti-CDK1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Center-peptide of human CDK1

Rabbit anti-SFN Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFN

Rabbit anti-GADD45A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GADD45A

Rabbit polyclonal MDM2 (Ab-166) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T).

Bax Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Bax

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.

Rabbit polyclonal APAF-1-ALT antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human APAF-1-ALT.

Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145
Modifications Phospho-specific

Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I).
Modifications Phospho-specific

Rabbit anti-P16 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human P16

DDB2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDB2

Rabbit anti-SIAH1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SIAH1

Phospho-CDK1-T161 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T161 of human CDK1
Modifications Phospho-specific

Rabbit Polyclonal Anti-NDST2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NDST2 antibody was raised against a 16 amino acid peptide near the amino terminus of human NDST2

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1

Cyclin B1 (CCNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Peptide sequence around aa.145~149 (A-F-S-D-V) derived from Human Cyclin B1

Rabbit Polyclonal Caspase-8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A.

Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

CDKN1A Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDKN1A

CCNB1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CCNB1

CHEK2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CHEK2

Phospho-CDK2-T160 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T160 of human CDK2
Modifications Phospho-specific

Rabbit Polyclonal Anti-SERPINB5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM

Thrombospondin 1 (THBS1) (19-32) goat polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Bovine, Equine, Human, Monkey, Porcine
Immunogen Synthetic peptide from N-Terminus of human THBS1 (NP_003237.2)

Goat Polyclonal Antibody against SERPINE1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1.

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

Rabbit polyclonal CASP8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8.

IGF1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1)

Rabbit Polyclonal p53R2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

Rabbit Polyclonal KAI1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen KAI1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KAI1.

Rabbit polyclonal antibody to SESN3 (sestrin 3)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 21 and 296 of SESN3 (Uniprot ID#P58005)

Rabbit polyclonal CDK4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4.

Anti-Human IGF-I Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IGF-I

Phospho-CDK6-Y13 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6
Modifications Phospho-specific

Rabbit Polyclonal Anti-CCNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3. Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE

USD 320.00

In Stock

Goat Polyclonal Anti-P53 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 280 aa to the C-terminus of human P53 produced in E. coli.